KEGG   Microcoleus sp. PCC 7113: Mic7113_4463Help
Entry
Mic7113_4463      CDS       T02374                                 

Definition
(GenBank) endoglucanase Y
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
mic  Microcoleus sp. PCC 7113
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5232342..5233682
Genome map
AA seq 446 aa AA seqDB search
MLPQFTEIVSLNPGQRCLRAVTAVALLLSLAGCTSGSSQGQPETPQPTSSDSWESPEPTP
TPKLPTPTLPGLRNAPSLPKSTANRELLEESWDIYRQQFIQVDGRVIDYEDSDRSTSEGQ
AYAMLRAVLIDDPTTFALSLDWAEKNLHRLSETGTHRDQLWAWKWGQAQPGKWGPIDKNF
ASDADIDAITALILASRRWNQPEYLNLARRKLRDLWYFSTIEVPGGKRYLLPGPAEAFAP
TPTTIYLNPSYYAPYAFRLFAQVDKEHDWMSLVKSSYESLEQSSKVSAAGLPSDWIALDT
QTGKYQPVPPQSKLQSVYSFDAYRVWWRVAWDAAWFNAPEAKKYLSTATKHLEKQWREQK
RLSARIDLQGKPTVNYEATSQYAMLIPAFRITNPDLAQELLKDKLLPQYKQGIWDDESAY
YTQNLAWLGILSPNVVSPQLLQPQPK
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgctccctcaatttactgaaattgtctctctcaatccgggtcagcggtgtttgagggcg
gttacagccgtcgcgcttttgctgagcttagcgggctgtacttccggctcttctcaggga
caaccggaaacgccacaaccgacttcatccgattcctgggagtcaccagagccaacacca
acgcccaagttaccaacacccacgctgcctgggttgagaaatgcgccttctttacccaaa
tcaacggccaaccgggagctactcgaagaaagctgggacatttatcggcagcaattcatt
caagttgatgggcgagtcatcgactatgaagatagcgatcgctccacctctgaagggcaa
gcttatgcgatgctgcgagcggttctaattgatgacccaaccacgtttgctctctcctta
gattgggccgaaaaaaatctccaccgactttcggaaaccggcactcatcgcgaccaactt
tgggcgtggaagtggggacaagctcaaccgggaaaatgggggccgattgacaaaaatttt
gccagtgatgcggacattgatgcaattaccgctctcatcctggcttcgcgccgctggaat
cagccagaatacctgaatttagcacgccgcaagctgcgagatttgtggtatttctccacc
attgaggtgccgggaggtaaacgctatctcttacccgggccggccgaagcctttgcaccc
acgcccacgactatctatctcaatccctcttattatgccccttatgcttttcgcctgttt
gcccaggttgacaaagagcacgattggatgagcctggttaaaagtagctatgaatccctc
gaacagtcgtccaaggtttcggcggctggcttacccagtgactggattgccctagacact
caaaccggaaagtaccagccggtaccacctcagagcaagcttcagagcgtttatagtttt
gatgcctatcgagtttggtggcgagtggcttgggatgcggcttggtttaacgctcccgaa
gctaaaaaatatctcagcacagcgaccaaacatttagagaagcaatggcgtgagcaaaag
cgcctgagtgctcggattgacctccagggaaaaccgaccgtgaactacgaggcgacatct
caatatgcgatgctcatacccgcctttcggataaccaaccccgatttagcccaggagtta
cttaaagataaactgttacctcaatataaacaggggatttgggatgatgaatcggcttac
tatacccagaatttggcctggttagggatactgtctcccaatgttgttagtcctcaactt
ctacaacctcagccgaagtga

DBGET integrated database retrieval system