KEGG   Microcoleus sp. PCC 7113: Mic7113_4540Help
Entry
Mic7113_4540      CDS       T02374                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mic00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5313253..5313969
Genome map
AA seq 238 aa AA seqDB search
MTIASSNAFNSSNSASSSNSSNPIPQVETRPDRNTHNGREPNLKPPSEELNEDMMKAVRT
MLLGVGEDPEREGLLKTPKRVAEAMRFLTSGYNQSLEELVNGAIFDEGHNEMVLVRDINF
FSLCEHHMLPFMGKAHVAYIPNQKVVGLSKLARVVEMYARRLQVQERLTRQIAEAVQTIL
EPQGVAVVMEGTHMCMAMRGVQKPGSWTATSAMVGVFQDDQKTREEFLNLIRHQPSFF
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgactattgcttcttccaacgcattcaatagctctaactcggcttcaagttccaacagc
tcaaatcccatcccccaggtcgagacacgacccgatcgcaacacccacaatggtcgggaa
cccaatttaaaaccgccctcggaagaactgaacgaggacatgatgaaggctgtgcggacg
atgctgttgggcgttggcgaagacccagagcgcgagggactgctgaaaactcctaagcgg
gtggcagaggcgatgcgcttcctgacgagtggctacaatcagtctctggaagaattagtc
aatggagccatctttgatgaaggccataatgaaatggttcttgtccgggatatcaatttt
ttcagcttgtgcgaacaccacatgctgccctttatgggtaaggctcacgttgcctacatc
ccaaatcaaaaagtcgtgggtttgagtaagttagctcgtgtggttgagatgtatgcacgg
cggctgcaagtgcaagaacgcctgacccgccagattgctgaagccgttcaaaccatcttg
gaacctcagggcgtagcggtcgtcatggaaggcactcacatgtgtatggcgatgcgcggt
gtgcaaaagcccggttcttggacagccacgagcgcgatggtgggtgtttttcaggacgac
caaaaaacccgtgaagaattccttaacctaatccgtcatcagccgagtttcttttaa

DBGET integrated database retrieval system