KEGG   Microcoleus sp. PCC 7113: Mic7113_4651Help
Entry
Mic7113_4651      CDS       T02374                                 

Definition
sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mic00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mic7113_4651
Enzymes [BR:mic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Mic7113_4651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5446077..5447033)
Genome map
AA seq 318 aa AA seqDB search
MSQGVVISLGSINADFQVRVDRQPDLSKGVLLAHDFVRLGGGKAANVAYLASRLGISTRL
IGHVGDDDLKEQALRSLREIDIDLQYVQAVAGQSTAVSMIAVPPDGKKGVLLAGNANYQW
SEEDVEMVSAAIESAPSGSVLVVDYEITPFIANHGISAAHERGIPVILDPSPVKYVDQSL
FSQISYIVPDAQEAKQLTGIAIDSVDHAVEAGRYLVEQGVKNAFVKLKDGGCVLVNSEQV
VHIPPTPVDVVDATGAGDAFAGGLAVAVVEGKSLLDAACLATAASHAAVTQYGSQPAYPT
RTQLDALFEQIVNHAHVL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagggagtggtgatttctctcggcagtatcaatgctgattttcaagtgcgagtc
gatcgccaaccagacttgagtaagggggtactactagcacacgattttgtgcgattgggg
ggtggaaaagcagcgaatgttgcctatctggcgagtcgcctggggatttctacgcggtta
atcggtcatgtgggagacgatgacttgaaagaacaggcattgcgatcgctacgggaaata
gatatcgatctgcaatatgtgcaggctgtcgcgggtcaaagtactgctgtttccatgatt
gcggtgccgccagatggcaagaaaggtgttctcctagctggcaatgcgaattaccaatgg
tcagaagaagatgttgaaatggtgagtgcagccattgaaagcgccccctctgggtcagtt
ttggttgttgattatgaaattactccttttattgccaatcacggcatttcggcagcccat
gaacgtggcattcctgttatccttgacccttctccggtaaagtatgtggatcagtcgttg
ttttctcaaatcagctatattgtccccgatgcccaggaagcaaagcagttaacagggatt
gcgatcgattctgttgaccatgcggttgaggcgggtcgctatctggtagaacagggagtt
aagaatgcctttgtgaagctaaaagatggaggttgcgttctagtgaactccgaacaggtt
gtgcatattcccccgactcccgtggatgtggttgatgcaactggggcaggtgatgcattt
gcaggaggtctagccgttgccgttgttgaaggaaaatcccttttagatgcggcttgtttg
gcgacggcggcttcccatgcggctgttacccagtatggttctcaaccggcttacccgacg
cgaacgcaacttgatgcactatttgagcaaattgtcaatcatgcccatgttctctga

  All links  
No link information was found.   
DBGET integrated database retrieval system