KEGG   Microcoleus sp. PCC 7113: Mic7113_4680Help
Entry
Mic7113_4680      CDS       T02374                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:mic00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mic7113_4680
Enzymes [BR:mic01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Mic7113_4680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5479831..5480736
Genome map
AA seq 301 aa AA seqDB search
MLLQTSTTVEPFLGPEFQASYEASQVVILPIPFEATTSYRKGCQNGPEALLEASVQLDYY
DDELDRETWRDALVHTHSYIADTRSLPPISSEKMLEVTRDTVSQLIQDGKFVIALGGEHS
ITTGIVDAYRIALNEPFTVIQIDAHGDMRYEYEGSIHSHACVMRRIIDMGLPTLPVGIRS
LCKEEADLIKAQSIPVMWAREIAKNPNWIEQAIAKISTPRVFITIDVDGIDPSIMPGVGT
PEPGGLSWYGLTDFLRRVFETHQVIGCDVMELAPVVDSVVSQFTAAKLVYKLIGYQANVK
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgctcctgcaaacatctactaccgttgagccatttctagggcctgaatttcaggcatct
tacgaagcgtcacaagtggtcattttacccataccctttgaggcgacaaccagctaccgc
aaaggctgccaaaatgggccagaagcgctcctagaagcctctgtgcagctcgattactat
gatgatgagctcgatcgcgaaacctggagagatgctctcgtccacacccactcctatatc
gccgatacgcgctctttgccaccgatttcctccgagaagatgctggaagtcactcgtgac
actgtgtctcaactgattcaagatggcaaatttgtcattgccttaggcggcgaacacagc
attacgaccggtattgtggatgcctaccgcattgccttaaacgaacccttcacagtgatt
caaatcgatgcccatggcgatatgcgctatgagtacgaaggttcgattcacagccatgcc
tgcgtgatgcgccgaatcatagatatggggttacctactctcccggttggcatccgcagt
ctgtgtaaagaagaggctgacttgattaaagcccaatcgattcccgtgatgtgggcacgg
gagattgccaaaaatcccaattggatcgaacaagcgatcgccaaaatttctacaccacgg
gtatttatcaccattgatgtcgatggcatcgatccctctataatgccgggagttggtaca
cccgaaccgggcggattgagctggtatgggctgactgacttcctcaggcgagtgtttgaa
acccatcaagtgattggttgcgatgtcatggaattagcacctgttgttgattcagtggtg
tctcaatttacagccgccaaattagtctataagttaattggctatcaagctaacgtaaaa
cgttag

DBGET integrated database retrieval system