KEGG   Microcoleus sp. PCC 7113: Mic7113_5046Help
Entry
Mic7113_5046      CDS       T02374                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mic00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mic7113_5046
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mic7113_5046
   00052 Galactose metabolism
    Mic7113_5046
   00500 Starch and sucrose metabolism
    Mic7113_5046
   00520 Amino sugar and nucleotide sugar metabolism
    Mic7113_5046
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mic7113_5046
   00524 Butirosin and neomycin biosynthesis
    Mic7113_5046
Enzymes [BR:mic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mic7113_5046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5896228..5897130
Genome map
AA seq 300 aa AA seqDB search
MVESEVIGIDLGGTAIKLGRFHTDGTCVQSLSVATPQPATPTAVVEAITQAITQLTSNHS
IIAAIGVGTPGPTDAAGRIARVAINLSGWNDVPLAEMLEAKTGCPTVIANDANCAGLGEA
WLGAGRRFRHLILLTLGTGVGGAIILDGKLFTGHQGAAGELGLITLNPDGPMCNSGNRGS
LEQYVSVQAIRRRTGKEPAELGAMAKEGDKSALEFWQSYGRNLGIGLASLIYILTPEAIV
IGGGVSASAEFFFPAALAEIEQRVLPSSRAGLKLLVAELGNQAGMVGAAKLAWQMVEIGG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtggttgagtccgaggtcattggcatcgatttagggggaactgcaatcaagctgggacga
tttcacacagatgggacttgtgtacagtctttaagtgtggcaacaccgcaacccgcaaca
ccaacggcggttgtggaggcaatcacccaagccattacccaacttacttctaatcactca
attattgcagcgatcggtgtgggtactcctggccccacggatgcagccggtcgcattgct
agagttgccattaacctatcaggttggaacgatgtccccctagctgagatgttagaagcc
aagacgggttgccctaccgtgatcgctaatgatgccaactgtgccgggttgggagaagct
tggttaggcgcggggcgtcggtttcgccatctgattttgttgacgttaggcacaggggtt
ggcggtgcaattattctggatggtaaactctttaccggtcatcagggggctgccggggag
ttggggttaattacgttgaatccagatggcccaatgtgtaatagcggaaatcgaggttct
ttggagcaatatgtctcggttcaggccattcgacgccgtactggaaaggaacccgctgaa
cttggtgctatggcgaaagagggcgataagtccgctttggaattttggcaaagctatgga
cgcaatttaggaattgggttagctagcctcatctatatcctgactccggaagcgattgtg
attggcggtggagtcagtgcgagtgcggagtttttctttcctgcggctttagctgaaatt
gagcaacgagtattgccgagttcccgtgctgggttaaagttactggtggctgagttgggc
aatcaggctggaatggtgggggcggcaaaattggcttggcaaatggtggaaattggcggt
tag

DBGET integrated database retrieval system