KEGG   Microcoleus sp. PCC 7113: Mic7113_5177Help
Entry
Mic7113_5177      CDS       T02374                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:mic01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mic00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mic00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6073980..6074687
Genome map
AA seq 235 aa AA seqDB search
MTQSDGSSRTLVVDIGGSGVKVMVLDEAGNPLTERSRVETPQPPKPDAVIDAIAQLAAGQ
GEFDRVSVGFPGVVSCGITRTAVNLDPDWMGFDLATALSERLGKPVRVANDADVQGMAAI
VGKGVEMVITLGTGFGSALFVDGKLVPNLEMGHHPFRKGETYEQQLGRAALDAVGQKKWN
TRLEKAIACLDHLFNYDYLYIGGGEAKKITIELPANVKIVPNVNGLLGGIVLWQD
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgactcaatcagacggatcgagccgcactctcgtcgtggacattggcggcagtggcgtc
aaggtgatggtattagatgaagccggtaatcccctgacagaacgcagccgtgtggaaacg
ccccagccccccaaacccgatgctgtaattgatgcgatcgctcagttagcggcaggacaa
ggtgaatttgatcgcgtatcagtgggatttccaggtgttgtaagttgcggtatcaccaga
acagcggtgaacttagaccccgattggatggggttcgatcttgccacagccctttctgaa
cgtttgggaaaacccgtgcgggtggcgaatgatgccgatgtgcaaggaatggcggctatt
gtcgggaaaggggtggaaatggtgatcaccctgggtacgggatttggttctgccctattt
gtagatgggaaactggtgcccaatttggaaatgggacatcatccgttccgcaaaggggaa
acctatgagcagcagttgggacgtgcagcgttggatgcagtgggtcagaaaaaatggaat
actcgcttagaaaaggcgatcgcctgtctggatcatctgtttaattacgattatctctac
atcggcggcggtgaagcgaagaaaatcaccatcgagctacctgccaatgtgaaaattgtg
cccaatgtcaatggtttgctgggtgggattgtgttgtggcaggattag

DBGET integrated database retrieval system