KEGG   Microcoleus sp. PCC 7113: Mic7113_5177Help
Entry
Mic7113_5177      CDS       T02374                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mic00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mic7113_5177
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mic7113_5177
   00520 Amino sugar and nucleotide sugar metabolism
    Mic7113_5177
Enzymes [BR:mic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Mic7113_5177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6073980..6074687
Genome map
AA seq 235 aa AA seqDB search
MTQSDGSSRTLVVDIGGSGVKVMVLDEAGNPLTERSRVETPQPPKPDAVIDAIAQLAAGQ
GEFDRVSVGFPGVVSCGITRTAVNLDPDWMGFDLATALSERLGKPVRVANDADVQGMAAI
VGKGVEMVITLGTGFGSALFVDGKLVPNLEMGHHPFRKGETYEQQLGRAALDAVGQKKWN
TRLEKAIACLDHLFNYDYLYIGGGEAKKITIELPANVKIVPNVNGLLGGIVLWQD
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgactcaatcagacggatcgagccgcactctcgtcgtggacattggcggcagtggcgtc
aaggtgatggtattagatgaagccggtaatcccctgacagaacgcagccgtgtggaaacg
ccccagccccccaaacccgatgctgtaattgatgcgatcgctcagttagcggcaggacaa
ggtgaatttgatcgcgtatcagtgggatttccaggtgttgtaagttgcggtatcaccaga
acagcggtgaacttagaccccgattggatggggttcgatcttgccacagccctttctgaa
cgtttgggaaaacccgtgcgggtggcgaatgatgccgatgtgcaaggaatggcggctatt
gtcgggaaaggggtggaaatggtgatcaccctgggtacgggatttggttctgccctattt
gtagatgggaaactggtgcccaatttggaaatgggacatcatccgttccgcaaaggggaa
acctatgagcagcagttgggacgtgcagcgttggatgcagtgggtcagaaaaaatggaat
actcgcttagaaaaggcgatcgcctgtctggatcatctgtttaattacgattatctctac
atcggcggcggtgaagcgaagaaaatcaccatcgagctacctgccaatgtgaaaattgtg
cccaatgtcaatggtttgctgggtgggattgtgttgtggcaggattag

DBGET integrated database retrieval system