KEGG   Microcoleus sp. PCC 7113: Mic7113_5324Help
Entry
Mic7113_5324      CDS       T02374                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mic00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mic7113_5324
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mic7113_5324
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mic7113_5324
Enzymes [BR:mic01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mic7113_5324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6241507..6242811)
Genome map
AA seq 434 aa AA seqDB search
MTQATQHQTQQTSATFKALKCKECGTEYEPQAIHVCEECFGPLEVSYDYDALRRHVTRET
IQAGPNSIWRYRPFLPVMTDNPIDVGTGMTPLVKSNRLARRLGLKNLYIKNDAVNMPTLS
FKDRVVSVALTRAKELGFSTVSCASTGNLANSTAAIAAHAGLDCCVFIPADLEAGKVLGT
LIYSPTVMAVEGNYDQVNRLCCEVANTHGWGFVNINLRPYYSEGSKTLGYEVAEQLGWKL
PDHIVAPLASGSLFTKIYKGFQEFIQVGLVDDKKVRFSGAQAEGCSPIAQAFREGRDFVT
PVKPNTIAKSIAIGNPADGVYAVDIAQKTGGNIESVSDAEIVEGMKLLAETEGIFTETAG
GTTIAVLKKLVEAGKIDPDETTVVYITGNGLKTQEAIQGYIGEPLTIEPKLDSFERALER
SHTLDRLEWQQVLI
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggcgacccaacaccagacacaacagacatctgccacgtttaaagccttaaag
tgtaaagaatgtgggacagagtacgaaccccaagccatacacgtttgtgaagagtgtttt
ggtcccctggaagtgagctatgactacgacgccctccgccgtcatgtcacccgcgaaaca
attcaggctggcccgaattccatttggcgctatcgtcccttcctacccgttatgaccgat
aaccccatcgatgtgggtaccggcatgacgcccttagtgaagtcgaaccgcttggcacga
cgcttgggtctgaaaaacctctatatcaagaatgatgccgttaacatgcccaccctcagc
ttcaaagatcgggtggtgtccgttgctctaactagagcgaaagaacttggtttctcgacg
gtatcctgtgcgagtacgggtaatttagcgaattctacagccgcgatcgcagctcacgcc
ggtttagactgttgcgtgtttattcccgccgacttagaagcgggtaaagttctcggtacc
ctaatctacagccccaccgtcatggctgtggaaggcaactacgaccaagtcaaccgactt
tgttgtgaagttgctaatacacatggatggggatttgtcaatatcaatttacgcccctac
tactctgaaggctctaaaaccctcggctatgaagtagctgaacaattaggttggaagcta
cccgatcacattgttgcccctctcgcttcgggttccttgttcaccaaaatctacaagggc
ttccaagaattcattcaagtgggtttggttgacgataaaaaagttcgcttcagtggtgca
caggcagagggctgttcccccatcgctcaagccttccgcgaaggacgggattttgtcacc
ccggttaagccgaacaccattgctaagtcgattgccattggcaacccggcggatggcgtg
tacgcggtggacattgcccaaaaaactgggggtaatattgaatccgtcagcgatgcagaa
attgtggaagggatgaagctgttggcagaaactgaaggcatcttcaccgaaacggcaggt
ggcacaacaatcgccgtcttgaagaaattggtagaagctgggaaaattgaccccgatgaa
acgaccgtggtttacatcacggggaatggtttgaaaactcaagaagccattcaaggctat
attggggaacccttgacgattgagccgaagttggatagttttgagcgggcattagagcgt
tcccacaccctcgaccgcctagaatggcaacaagttctgatttaa

DBGET integrated database retrieval system