KEGG   Microcoleus sp. PCC 7113: Mic7113_5384Help
Entry
Mic7113_5384      CDS       T02374                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
mic  Microcoleus sp. PCC 7113
Brite
Enzymes [BR:mic01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     Mic7113_5384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
6306288..6306986
Genome map
AA seq 232 aa AA seqDB search
MIELYYWTTPNGHKITMFLEEVGLPYTIIPVNIGAGDQFKPDFLKIAPNNRIPAIIDHEP
ANGGEPISVFESGAILLYLAEKTGKLIPSDLRQRVEVLQWLFWQMGGLGPMAGQNHHFSQ
YAPEKISYAIDRYVNETGRLYAVLNQRLADREFVAGNYSIADIAAYPWIVPHENQGQKLE
DFPNLKRWFETIQTRPATLRAYEKAESFKNQALDIEKSRSLLFNQSATTVQP
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgattgaactttactattggacaacacccaacggtcataaaatcacgatgttcttggag
gaagttggactcccttacaccattattcccgttaacattggtgctggcgatcaatttaag
cccgactttctcaagatagcccccaacaatcgcatccccgccattattgaccacgaaccc
gctaatgggggtgaacccatttcagtctttgaatcaggtgcaatcttgctgtacttagcc
gaaaaaaccgggaaactgattcccagtgatttgcgccaacgagttgaagtccttcaatgg
ttattttggcagatggggggacttgggccaatggcagggcaaaatcaccacttcagccaa
tatgccccagaaaagatttcctatgccatcgaccgttatgtgaatgaaacagggcgttta
tacgctgtcctgaatcagcgattggcagatcgagaatttgttgctggcaactattcaatc
gccgatattgccgcctatccctggatcgtcccccacgaaaatcaaggccaaaagctagaa
gatttccccaacctgaagcgctggttcgagacaattcagacacgtccggcaacccttcgt
gcctacgagaaagcagaatccttcaaaaatcaggcgctcgatattgaaaaatcccggtca
ttgctatttaatcagtcagccacaaccgtacagccttag

DBGET integrated database retrieval system