KEGG   Microcoleus sp. PCC 7113: Mic7113_5438Help
Entry
Mic7113_5438      CDS       T02374                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mic00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6365521..6367029
Genome map
AA seq 502 aa AA seqDB search
MPFPRSSGILLHPTSLPSRFGIGDLGLEAYKFIDFLAQSDQQLWQILPLGPTGYGNSPYM
CYSSMAGNPLLISPEKLQDQGLLTDEDFANLPEFPVDRVDYERVKQTKMPMLRKACDRFQ
ANASEVERKQFSGFCDATASWLEDYALFMALHDTFEGTSWHTWEPEIAKAHPEAIEKWRQ
KLSAQIYFHQYLQFEFFRQWSELKQYANLHHIQIIGDIPIYVAHNSVDVWAHRDIFAINE
QTGEAALMAGVPPDYFSEDGQLWGNPVYKWESLQQDNFRWWVQRVQATLDYVDIVRIDHF
RAFESYWVVEQGETTAKNGKWVEAPGEAFFKVLQEKVGNLPIIAEDLGTITPEVLALRDR
FEFPGMKILHFAFGGGPDNPYLPFNYGRNYVAYSGTHDNDTTVGWFNQLSQHEKDSLLLY
LGSISPDGIQWDLIRLALSSVANQAIIPVQDLLGLGTEARMNFPSKAEGNWEWRYRPDVL
TGELRDRLKTLTYIYGRAPIRS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgccgtttcccagatctagtggtattctacttcatccgacttccttacctagtcgcttt
ggtattggtgacttaggcttagaagcttataaatttattgattttttagcacagagtgac
cagcaactgtggcaaatcttacctttaggacccacgggatatggcaactctccttatatg
tgttactcatcaatggcgggaaatccgctgttgattagcccagaaaaactgcaagatcag
gggctactaacggatgaagattttgccaatctgccggagtttcccgttgaccgtgtagat
tatgagcgggtgaagcaaacgaagatgccgatgcttcgtaaagcctgcgatcgcttccaa
gcgaatgcctcagaagtggaaagaaagcaattttcagggttttgtgacgcgacagcgagc
tggctagaagattatgctttgttcatggcgctgcatgatacctttgagggcacaagttgg
catacttgggaaccggaaattgctaaggctcatccagaggcgatcgagaagtggcggcaa
aagttaagcgcccaaatctatttccaccaatacttgcagtttgagttcttccgccagtgg
tcggagttaaagcagtacgccaacttgcatcatatccagattattggtgatatcccgatt
tatgtggcgcataatagtgtggatgtctgggcgcatcgggacatttttgcgatcaatgaa
cagaccggtgaagccgctttgatggcaggggttccccccgattatttcagtgaagatggc
cagttatggggcaatccagtttacaaatgggagtcgttacagcaggataacttccgatgg
tgggtgcaacgtgttcaggcaacactggattatgtagacattgttcggattgaccatttc
cgagcgtttgagtcttactgggtggttgaacagggcgaaactactgccaagaacgggaag
tgggttgaggcaccgggagaggcattttttaaggtattgcaagagaaggtgggcaatctg
ccgattattgcggaggatttaggcaccatcacgcctgaagtgttagccttgcgcgatcgc
tttgagttccctggtatgaagattttgcactttgcttttggtggaggtcccgataatcct
tatttgccttttaactatgggcgtaattatgtcgcttatagcggtactcacgataatgac
acaacagtaggctggttcaatcagctttcacaacacgaaaaggatagtttattactttac
ttaggaagtattagccctgatggtattcagtgggatttaatccgtcttgccctcagtagt
gtagccaaccaagcaattattccagtgcaagatctcttaggtctgggtacagaagctcgg
atgaactttccgagtaaagcggaaggtaattgggaatggcgctatcgacccgatgtgttg
accggagaattacgcgatcgcctcaaaaccctcacttacatttatggtcgtgccccaatt
cgttcttaa

DBGET integrated database retrieval system