KEGG   Microcoleus sp. PCC 7113: Mic7113_5512Help
Entry
Mic7113_5512      CDS       T02374                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
mic00240  Pyrimidine metabolism
mic00250  Alanine, aspartate and glutamate metabolism
mic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mic00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mic7113_5512
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mic7113_5512
Enzymes [BR:mic01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Mic7113_5512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace ComA
Motif
Other DBs
NCBI-ProteinID: AFZ21148
UniProt: K9WLV0
Position
complement(6446765..6447760)
Genome map
AA seq 331 aa AA seqDB search
MATTVWTRRHVLGLADFTPAEFDTVLQTAASFREVLSTRTKKVPALQGQVVANLFFEPST
RTRSSFELAARRLSADTLNFAAGTSSLTKGETILDTAKTYLAMGADMMVIRHREAGVPHA
IAAEMNQLGVRVSILNAGDGQHEHPSQGLLDLFTITSLIDFEYPRLGLLAGKKIAIVGDI
LHSRVARSNIWSLTSSKAEVHLAGPPTLLPKLLAQIGDSSLPNRNIFLHWELEPALKDAD
FVMTLRLQKERMTSHLLPSLREYHQHFGITRDRLKLCKPDVKILHPGPVNRGVEVSSDLM
DDPEFSLISQQVTSGVAVRMALLYLMGSGKN
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggctactaccgtttggacacgccgccacgttcttgggttggctgatttcacacccgca
gaattcgatacagtcttgcaaacggctgctagctttcgggaggtactctcaacgcgaacg
aaaaaggtacccgcgttgcaggggcaagtggttgccaatctgttctttgaaccctcgacg
agaactcgcagtagttttgagttggcggcaaggcgtctgtctgccgatacgctcaatttt
gctgcgggtacctcttccctaaccaaaggggaaaccattctggatacggcgaagacctat
ctggcaatgggagcggatatgatggtgattcgccatcgggaagctggggtaccccatgcg
atcgcggctgaaatgaatcaacttggtgtccgagtcagcatcctcaatgcgggcgatgga
cagcacgaacatccctcccaaggtttgcttgacctgtttacgattacatctctaattgat
tttgaatatcctcgattagggcttttagcggggaaaaagattgcgattgtgggggacatt
ttgcactcacgggttgcccgttctaatatctggagtttgacatctagcaaggccgaagtg
catctggcaggcccaccaacactactccctaagttgttggctcaaattggagattcttcc
ctacccaatcggaatatttttctccactgggaactcgaacccgcattgaaagatgccgat
tttgtgatgactttacggctacaaaaagagcgcatgacctcacatttgttgccaagttta
cgagaataccatcaacattttggaattacacgcgatcgcttaaaactgtgcaaacccgat
gttaaaattctccacccaggcccggtcaaccgaggggtagaagttagctctgacttgatg
gacgatccagagtttagtctgatttctcagcaagtaacgagtggtgttgcggtgcggatg
gcattactgtacttgatgggtagcggcaaaaattag

DBGET integrated database retrieval system