KEGG   Microcoleus sp. PCC 7113: Mic7113_5562Help
Entry
Mic7113_5562      CDS       T02374                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mic00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mic7113_5562
  Amino acid metabolism
   00340 Histidine metabolism
    Mic7113_5562
Enzymes [BR:mic01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Mic7113_5562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6512268..6513569
Genome map
AA seq 433 aa AA seqDB search
MLRIITQQAEAQIELRRIRDRTSQDHVIHKEATVREVLQAIKRQGDKALLHYTEEFDHQT
LSIDGLRVSGSELDAAYQQVSKELLDAIQLAAQQIEAFHRQRVPKSWVQFGDDEIVLGKR
YTPVDRAGIYVPGGRASYPSTVLMNAIPAKVAKVPQVVMVTPPGSDKTINPAVLVAAQEA
GVQEIYRVGGAQAIAALAYGTETIPKVDVITGPGNIYVTLAKKLVYGTVGIDSLAGPSEV
LIIADTAANPVYIAADLLAQAEHDPMAASILLTSEAQLAKQVQEEVERQLKDHPRRLLTE
KAIAHFGLIVLVDSLDEAAELSNEFAPEHLELEIAEPWDLLEKIRHAGAIFLGHSTPEAV
GDYLAGPNHTLPTSGAARYASALGVETFMKHSSLIQYSSTALNKVSSAIQALAEAEGLPS
HADSVRLRTQEEL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaatcattactcagcaggctgaggcacaaattgaactgcgacgtatccgcgat
cgcacttctcaagaccacgttattcacaaagaagcgacggtgagagaggtcttacaggcg
attaaacgccagggagacaaagcactcttgcactataccgaggaattcgatcaccaaacc
ttaagtatcgacgggctgcgcgtcagtgggtcagaattggatgctgcttaccagcaggta
tccaaggaattactcgatgccattcagttggcagcgcagcaaatagaggcatttcatcga
cagcgcgtcccaaaatcttgggtacaatttggcgacgatgagatcgtcttaggcaagcgc
tatacgcccgtggatcgagcaggaatttatgttcctgggggtagggcatcctatcccagt
accgtgttgatgaacgccatccccgccaaggtggctaaagtccctcaagtcgtgatggtg
acgcctcctggctcagacaaaacgattaatccggctgtcctcgtggcagcgcaggaagct
ggggttcaagaaatttaccgggtcggtggagctcaggcgatcgcggctttagcttatggc
acggaaaccattcctaaagtcgatgttattactggtcctggcaacatttacgtcaccttg
gcgaaaaaactggtctacggaacggtaggcattgactccttggctggcccatcggaggtg
ttaatcatagcggatacagctgctaatccggtctacattgccgctgatcttttggctcag
gccgaacatgacccgatggccgcttccattcttctcacctccgaagcccaactggcgaaa
caagtgcaggaagaagtggaacggcaactcaaagaccatccgcgacgcctgctgaccgaa
aaagcgatcgctcactttggtttaattgtcctagtggattccctggatgaggcggcggaa
ctctctaacgagttcgccccagaacacctggaacttgaaattgctgaaccgtgggattta
ctggagaaaattcgccacgctggagcgatttttctaggccactccacccccgaagccgtg
ggagactacctggcgggccctaatcatactctaccgacctccggtgctgcccgctacgcc
tctgctttgggtgtcgaaacctttatgaagcactccagtttgattcagtactcatcgaca
gccctcaacaaagtttcgagtgctattcaggcgctagctgaagctgaagggttaccttct
catgcggactcggtacgattgcggacgcaggaggagctataa

DBGET integrated database retrieval system