KEGG   Microcoleus sp. PCC 7113: Mic7113_5580Help
Entry
Mic7113_5580      CDS       T02374                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:mic00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mic7113_5580
   00052 Galactose metabolism
    Mic7113_5580
   00500 Starch and sucrose metabolism
    Mic7113_5580
   00520 Amino sugar and nucleotide sugar metabolism
    Mic7113_5580
Enzymes [BR:mic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mic7113_5580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6535889..6536803
Genome map
AA seq 304 aa AA seqDB search
MLIHNVRKAVIPAAGFGTRLFPATKAVKKEFFPIIDRDGRAKPVIMVIVEEAISAGIEEI
GIVVQKSDRVLFEDFFKVPPPQNLFNKLSLQNQEYSHYIQELGQRITILTQNEQEGFGHA
VFCAKEWVNNEPFLLMLGDHLYASENEISCARQLLEVYQQVSQSVIGLRVTPAEVIHHYG
CATGTWKQSDSILSMTQIYEKPSLEYARKHLHIDGMNDEQFLSIFGMYILQPKILDYLQY
NIIHNIRERGEFQLTSALDRLRQEEGITGYVVQGQCFDTGLPDVYRQTMFDFRHAGYPML
DIEL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgctaattcataacgttcgtaaagccgtaattccagcagcgggttttgggactcgcttg
tttccagccaccaaagcggttaagaaagaatttttccccattattgatcgtgatgggcga
gcgaaacccgtgattatggtgatagtagaagaggcgattagtgcgggaattgaagaaatt
gggatagttgtgcaaaagagcgatcgcgtcctttttgaggatttctttaaagttccaccc
ccacaaaatctattcaacaaactatccctacaaaatcaagaatatagccactatatccaa
gaattaggacagcgaatcactattctgacgcaaaacgaacaggaaggctttggtcatgct
gtattctgtgccaaggaatgggtcaataatgaaccctttctcctgatgttgggcgatcat
ctttatgcctctgagaatgaaatttcctgcgcccgtcaacttttagaggtttatcaacaa
gtctctcaaagcgtgattggtttgcgcgtaacacccgcagaggtgattcatcactatggc
tgtgctactggaacctggaaacagtcagactcgattcttagtatgactcagatttatgaa
aaaccgagtcttgaatatgcgagaaagcatcttcatattgatggcatgaacgatgagcaa
ttcctatccatattcggcatgtatatcctccagccaaaaatcttggattatctacaatac
aacattatccacaacatccgcgaacggggagaatttcaactcacctctgctttagatcga
ttgcggcaagaggaaggtataacggggtatgttgtccaaggacagtgttttgatacagga
cttcccgatgtctatcggcagacgatgtttgattttcgccatgccggttatccgatgttg
gatattgaactctag

DBGET integrated database retrieval system