KEGG   Microcoleus sp. PCC 7113: Mic7113_5650Help
Entry
Mic7113_5650      CDS       T02374                                 

Definition
glycosyl hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mic00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mic7113_5650
Enzymes [BR:mic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Mic7113_5650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6611485..6613380
Genome map
AA seq 631 aa AA seqDB search
MISGQKGRRPDVACVPCSMEFWGYLPVLNLTLPSSIEIPVSLKVKASDKMKISKMLIFII
VIALSCVFAIAYGFSAKSNAQTPSKAAASKIVINQIGYYPNTTKTALLINLSAPKPGKVQ
LVSNRTKRTVFETGLSAPQQDGASQDIIQTIDFSKFNKEGSYYLKSGNIKSYPFQIGKNI
YRETLSKLLRSYYLQRCGVGVRDSASGVNHPPCHLSDGLIAHTDAFNQGGKHKPAIGGWH
DAGDYGKYVGPTAVTVGRLLSLYEQYPKLFSDRQLAIPESGNRRPDILDEVKIGLDWMLT
MQREDGAVYRKLSGKEWPGAILPHEDKQTRYVYGISTSETAKLAGAMAMAHRIYAPYDSK
LAQIYLKAAQKAWTFLQREPSAKVDWVEGDDSGSGAYLNQSPEGRLQTDKNDRLWAAAEL
FITTGNSAFEQYLVQNIASWTYSLYEWTDPSTLGMTDYLMLTGRKESENLKQQIKTKLLQ
RADSLMQKVAASGYRLANQDFIWASNKRAAEEGITLLHAYRITGNQNYFRAAVDQLDYLL
GRNHFNKSFITGVGSNSVRNVHHRIAQAKKIVIPGLMVGGPNAKAEDGIAPKDLGLLSYL
DDERSYATNEYAIDYNASVIGLMGMLMAQAN
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgatctccggtcaaaaggggcgaaggccagatgttgcttgtgttccttgttctatggag
ttctgggggtatctcccggtgttaaatctcacgctaccgagcagtattgagatcccagtc
agcttgaaggtaaaagcttcagacaaaatgaaaatcagcaaaatgttaatttttattatc
gtaattgcgctaagttgcgtctttgcgatcgcatacgggttctcggcgaagagtaatgct
caaactcccagtaaagcggccgcctcaaaaattgttattaatcaaattggctactatcct
aatactactaagacagctctattgatcaatttgagcgctcccaaacctggcaaagtccaa
ctggttagcaacagaactaaacggactgtttttgaaactggattgagtgcacctcaacaa
gatggagccagtcaggatatcatccagaccattgatttttccaaatttaacaaggaaggt
tcttattacctaaaatccggcaatattaagtcctatcctttccagattgggaaaaacatc
tatcgggagactttgagtaaactcctccgttcttattacttgcagcgatgcggtgttggt
gtacgagattcagccagtggcgtgaatcatcccccctgccacctcagcgatggactgatt
gctcatacggatgcattcaatcaaggcgggaagcacaaacctgcgattggcggctggcat
gatgctggggattacggcaagtatgtggggccaacggctgtgactgtgggtcgattatta
agcctttatgagcagtatcccaaactatttagcgatcgccaactcgctattcctgaaagt
ggcaatcgccgtcccgacatcctagatgaagtcaagattggattggattggatgctaacc
atgcaacgggaagatggcgctgtctaccgtaaactctcaggcaaagaatggccaggagca
attctgccccatgaagataaacaaacccgctatgtttatggcatctccacgtcagaaact
gcaaaattagctggtgcaatggcaatggctcatagaatttatgccccctatgattctaaa
ttagctcaaatttatttaaaagctgctcagaaagcttggactttcctacaaagagaacct
tcagcgaaagtagattgggttgaaggagatgatagtggttcgggtgcatacctaaaccag
tctcctgaaggtcgtttgcaaacagataagaatgatcggctttgggctgccgcagaatta
ttcattacgacaggtaattcagcctttgagcaatacttagttcaaaatattgcttcctgg
acttatagtttgtatgaatggacagacccttctaccttgggtatgactgactatctgatg
ttaacaggtcggaaagagtcagaaaatctaaaacaacaaatcaagacaaagcttcttcaa
cgggcagactctttgatgcaaaaagtagcggcgagtggctaccgtttggcaaatcaagat
tttatttgggcgtctaataaaagggcggctgaagagggaattactctacttcatgcctac
cgaatcacaggcaatcaaaactacttccgagcagccgttgaccagttagattacctacta
gggcggaatcattttaataaatcctttatcacaggtgtaggctctaactctgtacgaaac
gtacatcaccggatagcacaagcgaaaaaaattgtgattccagggttgatggtcggtggt
cctaatgctaaagcagaagatggaattgcaccaaaagatttagggcttttaagttatctc
gatgatgagcggtcttacgcgaccaatgaatatgcaattgattacaatgcttctgtgatt
ggactaatgggaatgttaatggcacaggcgaattga

DBGET integrated database retrieval system