KEGG   Microcoleus sp. PCC 7113: Mic7113_6047Help
Entry
Mic7113_6047      CDS       T02374                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:mic00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7076101..7077312)
Genome map
AA seq 403 aa AA seqDB search
MKAINLLGSTGSIGTQTLDIVTQYPDQFRIVGLAAGRNVEMLASQIRQFRPEIVAICVEE
KLPELKEAIKDLDPQPILLAGEAGVAEVARYGDADIVVTGIVGCAGLLPTIAAIEAGKDI
ALANKETLIAGGPVVLPLIEKHGVKLLPADSEHSAIFQCLQGVPKGGLRRILLTASGGAF
RDWPVEKLPEAKVTDALKHPNWSMGRKITIDSATLMNKGLEVIEAHFLFGMDYDRIDIVI
HPQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPDRIYTDWEQLDLVKAGSLTFREP
DHEKYPCMQLAYTAGRAGGSMPAVLNAANEQAVALFLDEKIGYLDIARCIEYVCDRHQAD
NCQNPSLDDIIAADQWARQEVLAAHKLMNQGNRLISLASTAQI
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcgattaatcttctcggttcaaccggctccattggcactcaaaccttagatatt
gtgactcagtaccccgaccaattccggattgtgggattggcggcagggcgtaatgtagag
atgttagcgtctcagattcggcagtttcgacccgaaattgtcgccatctgtgtcgaagag
aaattaccagaactcaaagaagcaataaaagacctcgacccccaacccatcctactcgcc
ggagaagctggggtggcggaagtcgcccgctacggcgatgcagatatcgttgtcacaggt
attgtcggctgtgcggggttgttaccgaccattgctgccattgaagcgggtaaagatatt
gctcttgccaataaagaaaccctgattgccggtggccccgtggtgctgccgttaattgag
aaacatggcgttaagctactaccggctgactcagagcattctgccattttccaatgcctt
caaggcgtacccaaaggcggattacggcgaattttgttgacagcctctgggggtgcgttc
cgggattggcctgtagaaaagttaccagaagccaaagtgacagatgccctcaagcatccc
aactggtcaatgggtcgcaagattaccatcgactctgccaccctgatgaataaaggattg
gaagtcattgaagctcacttcctcttcggcatggactacgatcgcatcgacatcgtgatc
catccccaaagcatcattcactccctgattgaactacaagatacctctgtcttagcccaa
ttgggatggcctgatatgcgcttacccctactttatgccctatcctggcccgatcgcatt
tacacggactgggaacaactcgatttagtgaaagctggtagcctcacctttagagaaccc
gaccatgaaaagtatccctgtatgcagctagcctatacggcgggacgtgccgggggttcc
atgcctgcggtattaaatgccgcaaatgagcaggcggttgcgctatttttagacgaaaaa
attggatatttagatattgcccgttgtattgaatacgtgtgcgatcgccaccaagcggat
aactgccaaaatccatctttagatgacattattgcagccgatcaatgggccagacaagaa
gttttggcagctcataaattgatgaatcaaggtaatcgtttgatttccctagcctctaca
gcccagatctaa

DBGET integrated database retrieval system