KEGG   Microcoleus sp. PCC 7113: Mic7113_6052Help
Entry
Mic7113_6052      CDS       T02374                                 

Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
mic00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mic00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mic7113_6052
Enzymes [BR:mic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Mic7113_6052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-ProteinID: AFZ21651
UniProt: K9WPC5
Position
complement(7082825..7083757)
Genome map
AA seq 310 aa AA seqDB search
MKPIIVFGSINMDLVAKTPRLPVAGETIKGDEFFTAGGGKGANQAVAAARLGISTQIVGR
LGNDDFGRQLLRHLQAAGVQTDGVLVDEATSSGVAVITVDDAGENNIIIIAGANGRLNET
DVERLRSKLPGAAALLMQLEIPMTTVQLAAQAAHSAGVPVILDPAPAQDIPDELYSRIDI
ITPNQLEASQLVGFPVDGEEAAAKASAELQQRGVSTVIVKLGDRGVFCATAEETFFVPAF
SVQAVDTVAAGDAFNGALAVALAQGRSLREAVVWGAAAGALSATKAGAQPSLPDRKTFET
FLKERGVGIC
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaatcattgtctttggcagcattaacatggatttggtcgccaaaactcctcgg
ttacctgttgcgggagagacgataaaaggagatgaattttttacagccgggggcggaaaa
ggggcaaatcaagccgtggcggcagcgcggctgggtatctccactcaaattgtggggcgt
ttagggaatgatgattttgggcgtcaactgctgcgtcatttacaagctgccggtgttcag
acggatggtgttttggtagatgaggcaacaagttctggcgtcgctgtgattacggtggat
gatgccggagaaaacaacattattattattgcgggtgccaatggacggttgaatgaaact
gacgtggaacgcctccgcagtaagttgccaggggcagccgctttgctgatgcagttggag
attccgatgacaaccgtacagttagcagcgcaagcggcacactccgcaggtgtacctgtg
attcttgatccagcaccggctcaagatattccagatgagctttactcacggatcgatatt
attactcccaatcagttggaagcgtctcagttagtcggttttcctgtagacggggaagag
gcagccgctaaagcgtcggctgagttacaacaacgaggtgtcagtacggtaatcgtgaaa
ctaggcgatcgcggtgtcttctgtgcgacggcagaggaaaccttctttgtcccagctttc
tcagttcaagcggttgatacggttgcggcgggtgatgccttcaatggtgctctagcagtc
gctttggctcaagggcgttctttgcgggaagcggtggtgtggggagcagccgcaggggca
ctttcggcaacaaaagcgggggcgcaaccttctttaccggatcgcaagacgttcgagacg
tttctgaaagaacggggtgtggggatttgttaa

DBGET integrated database retrieval system