KEGG   Microcoleus sp. PCC 7113: Mic7113_6629Help
Entry
Mic7113_6629      CDS       T02374                                 

Definition
RecD/TraA family helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mic03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pMIC7113.03:complement(60663..62873)
Genome map
AA seq 736 aa AA seqDB search
MSTNSTPQLESLEGIVERITFHSDESGYTVARFKVPRTPDLVTIIGNFAQIEAGQTLKLS
GIWRDHPKFGQQFQVTQYRETKPATLTGMEKYLGSGLIKGVGPVTAKRIVAHFGLETLDV
IENQIERLLEVPGIAHKRVKMIQSAWEKQKAIKEVMVFLQGHGVSTTYAVKIFKQYGDAA
IAKVTENPYQLAADIYGIGFVTADTLARNLGIEPGSEFRYRAGIVHVLGEAAEDGHCFLP
FEELVEQTVKRLAIDDHQPQKNAIARLIQQMGQLNELVLESSPDQLLCYKPSFFQTEQNL
AQRLRQQLTSPVTVDLPRVRRWLLRFREKTGIELSEQQQQAVEIAASERVLVLTGGPGCG
KTFTTRTIVALWKAMGFSIALAAPTGRAAQRLSEMTGQPASTLHRLLEFDPKTFGFKHDE
SNPMEADAIVVDEASMLDLFLAYSLMKAVKPEAQLLLVGDIDQLPSVGPGNVLRDLIVSQ
CVPVARLTQVFRQAQASQIVTNAHQINLGKYPQLESVSLTPRSDCLWLGAPEPDYGVQGI
MELLTDVIPQLGFNPTTDVQVLSPSTRGVVGTRNLNQVLQNLLNPPSASKAEVVRGGTIL
RVGDRLIQRVNDYQREVFNGDLGVIVAIDNEEQEIRVQFDQRQVTYDYADLLEVDLAWAV
TIHKSQGSEYPVVVLPLFPQHYLMLSRNLLYTGLTRAKRLAVIVGPKKAVAMAVNQVKDQ
KRYTGLAWRLSGKVLR
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaaatagcactcctcaactagaatccctggaaggaatcgtggaacggataacc
tttcattccgatgaatccggttacaccgttgcccgcttcaaagtcccccggactccggat
ttagtcaccatcatcggcaactttgctcagattgaagcagggcaaaccctcaagctttct
ggcatttggcgcgaccatcctaaatttggacaacagttccaagtgactcaataccgggaa
accaaacccgctaccctcacgggaatggaaaagtacttgggtagcggtttaatcaaaggc
gttggccccgtaactgccaagcgaattgtcgctcactttggcctggaaaccctcgatgtc
atcgaaaaccaaattgaacgcctgctggaagtgccaggaatcgcccataagcgggtgaaa
atgattcaaagtgcttgggaaaagcagaaagccattaaagaggtgatggtctttttgcaa
gggcatggggtgtccaccacttatgcggttaagatttttaagcagtatggagacgcggcg
atagccaaagtcactgagaacccctatcaactggctgccgatatctacggcattggcttt
gtcacggccgatactctagctcggaatttgggcatcgaacccggttcagaatttcgctac
cgggcgggaattgttcacgttttgggagaagcggcagaagatggacactgctttttgcct
tttgaggaactggtagagcagacggtgaaacgattggcgattgatgaccatcaaccccaa
aagaatgcgatcgctcgtctaatccaacagatgggtcagcttaatgagttagtcctggaa
agctcgcccgaccagctactttgctacaaaccctcctttttccaaaccgaacagaaccta
gcccagcgattacgacaacagctcacgagtcccgttacggttgacttgcccagagtccgc
cgttggctcttgcgcttccgggagaaaaccgggatagaactgagcgagcaacaacagcag
gcggtggagatagccgccagtgagcgcgtgttggtattgacgggtggccctggatgcggt
aagacgtttaccactcgcacgattgttgccttgtggaaagcgatgggcttctcgatcgct
ttggcggcaccaacagggagggcggctcagcggttgagtgaaatgacggggcaacctgct
tctaccttacatcggctgttggagtttgaccctaagacgtttggctttaagcacgatgag
tccaatccaatggaagccgatgcgattgtggtggatgaagcttccatgctggatttgttt
ttggcttactctctgatgaaagctgtcaaaccagaggctcaactgttgttggtgggagac
atcgaccagttgcctagcgtaggaccggggaatgtgctgcgggacttaattgtgtcacag
tgcgtccccgttgcccgactgacgcaggtattccgccaagcgcaagctagccaaattgtg
accaatgctcaccaaataaatcttgggaaatatccccagttggaatctgtttcccttacc
cctcgttctgactgtttgtggttaggagcaccggaaccggattatggggtgcaggggatt
atggagttgctgactgatgttattcctcagttggggtttaatccaacgactgatgtgcag
gtgctgtctccctcgacacggggggtggtgggaacccggaaccttaaccaagtgcttcag
aatctgctcaatccacccagtgcgagtaaagcggaggtggtgcggggaggaacgattttg
cgcgtgggcgatcgcttgattcaacgagtgaatgattatcaaagggaggtgttcaatggt
gatttgggggtgattgtagccatagacaatgaggagcaggaaatcagggttcagtttgac
caacgccaggtgacgtatgattatgcggatttgttagaggtggatttggcttgggcggtg
acgattcacaagtcgcaggggagtgagtatccggtggtggtgctgccgctgtttcctcaa
cattatctgatgctgtcgcgtaatctgctgtatacggggttgacgagagctaagcggttg
gctgtgatcgtggggccaaaaaaggcggtggcgatggcggtgaatcaggttaaagaccag
aagcggtatacggggctggcgtggcggttgagtgggaaggtgttgcggtag

DBGET integrated database retrieval system