KEGG   Mycobacterium indicus pranii: MIP_00661Help
Entry
MIP_00661         CDS       T02325                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mid  Mycobacterium indicus pranii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MIP_00661
Enzymes [BR:mid01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MIP_00661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(491655..492533)
Genome map
AA seq 292 aa AA seqDB search
MGVVVIGQIARDLVLRTDGPPTTDDSTTVVQRKELLGGKGANQAVGLAQLGVPVALIAVA
GDDDAGTSVLAQAQRDGIDVGGVARRGTTALLIDVVPKPPERMLLEDVPESSLIQVADLD
RSVFDTADTVSIQLQQPPATALEAAQRARRRGLRVVADGAPAEHIRADLLAAVDVIRADA
TEASLIAGREIGTAAQARELADRLLACGPGLVALAVPKVGDLVAWDGGSRLFEFADVDVV
DPTGAGDAFVAGLIAALRDGAAPPEAGELAAAAASATVQRLGGRPDLTALKA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgggcgttgtcgtgatcggccagatcgcacgcgatctggtgctgcgtaccgatgggccg
ccgacgaccgacgattccaccacggtcgtgcagcgcaaggagctgctgggcggcaagggc
gccaatcaggcggtcggcctggcgcagctgggcgtgccggtcgccctcatcgcggtggcc
ggtgacgacgacgcggggacgtcggtcctggcgcaggcccaacgggacggcatcgacgtc
ggcggcgtcgcgcgtcgcggcaccacggcgctgttgatcgatgtggtcccaaaaccgccg
gaacgcatgctcctcgaagacgtgcccgaaagctcgctgatccaagtcgccgacctcgat
cggtccgtgttcgacaccgccgacaccgtttccattcagctgcagcagccgccggccacc
gcgttggaagccgcgcaacgcgctcggcggcggggtctgcgcgtcgtggccgacggcgcg
cccgccgagcacattcgggccgacctgctcgcggcggtcgacgtgatccgcgccgacgcc
acggaagcctcgctcatcgcgggccgggagatcggcacggcggcgcaggcgcgcgagctg
gccgaccgcctgttggcctgcggtccgggactggtcgccctcgcggttccgaaggtcggt
gacctggtggcgtgggacggtggcagccggctcttcgaattcgccgacgtcgacgtggtg
gatccgaccggcgcgggcgacgcgttcgtggccgggctgatcgccgcgctgcgtgatggc
gccgcaccaccggaggccggcgagcttgcggccgcggccgccagcgctaccgttcagcgc
ctcggcggccggcccgacctgaccgcgctcaaggcgtga

DBGET integrated database retrieval system