KEGG   Mycobacterium indicus pranii: MIP_00812Help
Entry
MIP_00812         CDS       T02325                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mid  Mycobacterium indicus pranii
Pathway
mid00010  Glycolysis / Gluconeogenesis
mid00620  Pyruvate metabolism
mid00640  Propanoate metabolism
mid00680  Methane metabolism
mid01100  Metabolic pathways
mid01110  Biosynthesis of secondary metabolites
mid01120  Microbial metabolism in diverse environments
mid01130  Biosynthesis of antibiotics
mid01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MIP_00812
   00620 Pyruvate metabolism
    MIP_00812
   00640 Propanoate metabolism
    MIP_00812
  Energy metabolism
   00680 Methane metabolism
    MIP_00812
Enzymes [BR:mid01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MIP_00812
Lipid biosynthesis proteins [BR:mid01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MIP_00812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFS12552
UniProt: J9WDM6
Position
complement(585669..587624)
Genome map
AA seq 651 aa AA seqDB search
MTATNSAGPSSYPPSARFAEQANAGEELYRDAERDRLAFWAEQANRLSWATPFTEVLDWS
DAPFAKWFGDGKLNVAYNCVDRHVEAGHGDRVAIHWEGEPVGDHRSLTYSQLQTEVCKAA
NALTDLGLVAGDRVAIYLPLIPEAVIAMLACARLGIMHSVVFAGFTAKALQARIADADAK
LLITSDGQFRRGKPAPLKDAADEAVSDPDSPIEHVVVVRRTGIDVSWNDDRDLWWHDVVD
AASPAHTPQPFDAEQPLFLLYTSGTTGKPKGIVHTSGGYLTHAAYTHYFVFDIKADSDVF
WCTADIGWVTGHTYGVYGPLANGVTEVLYEGTPDSPSQHRHFEIIEKYGVTIYYTAPTLI
RTFMKWGREIPDAHDLTSLRLLGSVGEPINPEAWRWYRKVIGADSLPIVDTWWQTETGAT
MISPLPGIAAAKPGSAMRPLPGVSAKIVDDHGEELPPPGEAKGEHVTGYLVLDQPWPSML
RGIWGDPQRYVETYWSRFAEQGWYFAGDSAYYDTDGDIWVVGRIDDVMNVSGHRLSTAEV
ESALVGHAAVAEAAVVGATDETTGQAICAFVVLCADFEVHDGIVDDLRVEVAREISPIAR
PREVHVVPELPKTRSGKIMRRLLRDIAENRELGDTSTLLDPGVFDAIRAAK
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccaccaactctgcgggcccctcgtcgtatcccccgtcggcgcgattcgccgaa
caggccaatgcgggcgaggagctgtaccgcgacgccgagcgggaccggctggccttttgg
gccgagcaggccaaccggttgtcctgggcgacgccgttcaccgaggtgctggactggtct
gacgcgccgttcgccaaatggttcggcgacggcaagctcaacgtcgcatacaactgcgtg
gaccgccacgtggaggcgggccacggggatcgggtcgcaatccattgggagggcgagccc
gtcggtgaccaccgcagcctgacctactcgcagctgcaaaccgaggtctgcaaggccgcc
aacgcgctgaccgatctcggcctggtggccggtgaccgcgtcgcgatctacctgccgctg
atcccggaggccgtgatcgcgatgctggcctgcgcgcgcctcggcatcatgcacagcgtg
gtgttcgccggcttcaccgccaaagcgctgcaggcccgcatcgccgacgccgacgccaag
ctgctgatcaccagcgacgggcagttccgccgcggcaagcccgcgcccctcaaggacgcg
gccgacgaggcggtctcggacccggacagccccatcgagcacgttgttgtggtgcggcgc
accggaattgacgtgtcctggaacgacgaccgcgatctgtggtggcacgacgtcgtcgac
gcagcctcccccgcacacaccccgcaaccgttcgacgccgaacaaccgttgttcctgctg
tacacctcgggaaccaccggcaagcccaagggcatcgtgcacaccagcggcggctacctg
acccacgccgcctacacgcactacttcgtcttcgacatcaaggccgacagcgacgtgttc
tggtgcaccgccgacatcggctgggtcaccggacacacctacggcgtctacggcccgctg
gccaatggcgtcaccgaggttctctacgaaggcacacccgacagcccgtcgcagcaccgg
catttcgagatcatcgaaaagtacggcgtgacaatctattacaccgcgcccacgctgatc
cgcacgttcatgaagtggggccgcgagattcccgacgcccacgacctgaccagcctgcgg
ctgctgggctcggtcggcgagccgatcaaccccgaagcgtggcgttggtaccgcaaggtg
atcggcgccgacagccttccgatcgtcgacacctggtggcagaccgagaccggcgccacg
atgatctccccgttgcccggaatcgctgcggccaaaccgggttcggcgatgcggccgctg
ccgggtgtctcggcgaagatcgtcgacgaccacggcgaggagctgcccccaccgggcgag
gccaagggcgagcacgtcaccggctacctggtgctggaccagccgtggccgtcgatgctg
cgcggcatttggggcgatccgcaacgttatgtcgagacctactggtcccgattcgccgag
caaggctggtatttcgccggtgacagcgcctattacgacaccgacggcgacatctgggtg
gtcggccgcatcgacgacgtgatgaacgtgtcggggcatcggctctccacggccgaggtg
gagtcggcgctggtcggccacgccgcggtggccgaggcggcggtggtcggcgcgaccgac
gagacgaccggccaggccatctgcgcgttcgtcgtcttgtgcgcggacttcgaggtgcat
gacgggatcgtcgacgacctgcgcgtcgaggtggcccgggagatctcccccatcgcacgc
ccgcgcgaggtgcacgtggtgcccgagctacccaagacccgcagcggcaagatcatgcgc
aggctgttgcgggacatcgccgaaaaccgcgaattgggcgacacgtcaacgctgctcgat
cccggcgtgttcgacgcgatcagggcggcgaagtag

DBGET integrated database retrieval system