KEGG   Mycobacterium indicus pranii: MIP_00880Help
Entry
MIP_00880         CDS       T02325                                 

Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mid  Mycobacterium indicus pranii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mid00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
636691..637293
Genome map
AA seq 200 aa AA seqDB search
MALPDTAMSKMRVFDQDRAEAAVRELLCAIGEDPDRHGLRETPARVARAYREMFAGLYTD
PDSVLNTMFDEDHDELVLVKEIPLYSTCEHHLVSFHGVAHVGYIPGNDGRVTGLSKIARL
VDLYAKRPQVQERLTSQIADALVKKLNPRGVIVVVEAEHLCMAMRGVRKPGATTTTSAVR
GIFKTNAASRAEALDLILRK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcactgccggacaccgcgatgtccaagatgcgggtcttcgaccaggaccgtgccgag
gccgcggtccgcgagttgctgtgcgcgatcggcgaagacccggaccggcacggcctgcgg
gaaaccccggcccgcgtcgcccgcgcctaccgggagatgttcgccgggctctacaccgat
ccggacagcgtgttgaacaccatgttcgacgaggatcacgacgagttggtgctggtcaag
gaaatcccgctgtactccacgtgcgaacaccacctggtgtcgttccacggggtggcccac
gtcggctacatcccgggcaacgacggcagggtcaccggcctgtcgaagatcgcgcgactg
gtcgatctgtacgccaagcggccccaggtgcaggaacggctcaccagccaaatcgccgac
gccctggtgaaaaagctcaatccgcgcggggtgatcgtcgtggtcgaggccgagcacctg
tgcatggcgatgcgcggtgtccgcaagcccggagcgacgaccacgacctcggcggtgcgc
ggaatattcaaaacgaacgccgcttctcgagccgaggcgctcgacctcatcctgcggaag
tga

DBGET integrated database retrieval system