KEGG   Mycobacterium indicus pranii: MIP_00880Help
Entry
MIP_00880         CDS       T02325                                 

Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mid  Mycobacterium indicus pranii
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MIP_00880
Enzymes [BR:mid01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     MIP_00880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
636691..637293
Genome map
AA seq 200 aa AA seqDB search
MALPDTAMSKMRVFDQDRAEAAVRELLCAIGEDPDRHGLRETPARVARAYREMFAGLYTD
PDSVLNTMFDEDHDELVLVKEIPLYSTCEHHLVSFHGVAHVGYIPGNDGRVTGLSKIARL
VDLYAKRPQVQERLTSQIADALVKKLNPRGVIVVVEAEHLCMAMRGVRKPGATTTTSAVR
GIFKTNAASRAEALDLILRK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcactgccggacaccgcgatgtccaagatgcgggtcttcgaccaggaccgtgccgag
gccgcggtccgcgagttgctgtgcgcgatcggcgaagacccggaccggcacggcctgcgg
gaaaccccggcccgcgtcgcccgcgcctaccgggagatgttcgccgggctctacaccgat
ccggacagcgtgttgaacaccatgttcgacgaggatcacgacgagttggtgctggtcaag
gaaatcccgctgtactccacgtgcgaacaccacctggtgtcgttccacggggtggcccac
gtcggctacatcccgggcaacgacggcagggtcaccggcctgtcgaagatcgcgcgactg
gtcgatctgtacgccaagcggccccaggtgcaggaacggctcaccagccaaatcgccgac
gccctggtgaaaaagctcaatccgcgcggggtgatcgtcgtggtcgaggccgagcacctg
tgcatggcgatgcgcggtgtccgcaagcccggagcgacgaccacgacctcggcggtgcgc
ggaatattcaaaacgaacgccgcttctcgagccgaggcgctcgacctcatcctgcggaag
tga

DBGET integrated database retrieval system