KEGG   Mycobacterium indicus pranii: MIP_00884Help
Entry
MIP_00884         CDS       T02325                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyl dihydro pteridin pyrophospho kinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mid  Mycobacterium indicus pranii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mid00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
638579..639106
Genome map
AA seq 175 aa AA seqDB search
MAAMTRVVLSIGSNLGDRLARLQSVVDGLGDTVLAVSPVYETDPWGRVDQAPFLNAVLIA
DDPACDGQGWLARAQEFERAAGRVRGERWGPRTLDVDLIACYGQAEVTSRENNLTLPHPL
AHLRAFVLIPWLAVDPDARLTVAEGPRPVAQLLAELEPADRAAVRRSDLMLELTT
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
gtggcggcgatgaccagagtggtgttgtccatcgggtccaacctgggggaccggctggcg
cggttgcagtcggtcgtcgacgggctgggggacacggtgctcgccgtgtcaccggtgtac
gagaccgacccctggggccgggtcgatcaggcgccgttcctgaacgcggtgctgatcgcc
gacgacccggcctgcgacgggcagggctggctggcccgggcgcaggagttcgagcgcgcg
gcgggcagggtccgcggcgagcgctgggggccgcgcaccctcgacgtcgacctgatcgcc
tgttacgggcaagccgaggtgacctcgcgggagaacaacctgacgctgccgcatccgctg
gcccatttgcgggccttcgtgctgatcccctggctggcggtcgacccggacgctcggctg
acggtcgccgaagggccgcgtcccgtcgcgcagttgctggccgaactggagcccgccgac
cgtgccgccgtacggcgctcggacctgatgctcgagctcacgacctga

DBGET integrated database retrieval system