KEGG   Mycobacterium indicus pranii: MIP_00990Help
Entry
MIP_00990         CDS       T02325                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mid  Mycobacterium indicus pranii
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MIP_00990
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MIP_00990
   00650 Butanoate metabolism
    MIP_00990
  Amino acid metabolism
   00360 Phenylalanine metabolism
    MIP_00990
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MIP_00990
   00622 Xylene degradation
    MIP_00990
   00621 Dioxin degradation
    MIP_00990
Enzymes [BR:mid01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MIP_00990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
710870..711784
Genome map
AA seq 304 aa AA seqDB search
MAIVGSGNISTDLLYKLLRSDWLEPRWMVGIDPESEGLARARKLGLETTHEGVDWLLAQS
DKPDLVFEATSAYVHRDAAPKYAAAGIRAVDLTPAAVGPAVIPPANLRQHLDAPNVNMIT
CGGQATIPIVYAVSRAVADLGGVPYAEIVASVASLSAGPGTRANIDEFTKTTSKGVETIG
GAKRGKAIIILNPADPPMIMRDTIFCAIPEDADRDAIAKSIHDVVAEVQTYVPGYRLLND
PQFDDPSINSGGQALVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKESLTATAG
GAQS
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtggccattgtcgggtcgggcaacatcagcactgacctgctttacaagttgttgcgatcg
gactggctggagccgcgctggatggtcggcatcgaccccgaaagcgagggcctggcgcgg
gcccgcaagctgggtttggagaccacccacgagggcgtggactggttgctggcgcagtcg
gacaagcccgatctggtgttcgaggcgaccagcgcctacgtgcaccgcgacgccgcgccc
aagtacgcggccgccggcatccgggccgtcgacctgacgcccgccgcggtgggtcccgcg
gtgatcccgccggccaacctgcgccagcacctggatgcgcccaacgtcaacatgatcacc
tgcggcgggcaggccaccatcccgatcgtgtacgcggtgtcgcgcgccgtcgccgacctc
ggtggggtgccgtacgccgagatcgtcgcctcggtcgcctcgctgtcggcggggcccggc
acccgggccaacatcgacgagttcaccaagaccaccagcaagggcgtggagaccatcggt
ggcgccaagcgcggcaaggcgatcatcatcttgaaccccgccgatccgccgatgatcatg
cgcgacaccatcttttgcgccattcccgaggacgccgaccgcgacgcgatcgccaagtcc
atccacgacgtggtggccgaggtgcagacctacgttcccggctaccggctgctcaacgac
ccgcagttcgacgacccgtcgatcaactctggcggccaggcgctggtcaccacgttcgtc
gaggtcgagggggccggcgattacctgcccccctatgcgggcaacctggacatcatgacc
gccgcggcgaccaaggtcggcgaggagatcgccaaggaatccttgaccgcgacggccgga
ggagcgcaatcatga

DBGET integrated database retrieval system