KEGG   Mycobacterium indicus pranii: MIP_01554Help
Entry
MIP_01554         CDS       T02325                                 

Definition
Formamido pyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mid  Mycobacterium indicus pranii
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mid03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1096654..1097517
Genome map
AA seq 287 aa AA seqDB search
MPELPEIEALADHLRRNAVGLTVGRVDIAALSVLKTFDPPISALHGQTVVGADRWGKYLG
LRTDDLYLVAHLSRAGWLRWSDTLAAAPLRPGKGPIALRVHLGTPGEAPGFDLTEAGTQK
RLAVWLVSDPQQIPQIASLGPDALDLGPDDLARVLAGNTGRIKTVITDQKVIAGIGNAYS
DEILHVAKISPFATAGKLSEKQLAALHDAMITVLTDAVSRSVGKGAATLKGEKRSGLRVH
ARTGLPCPVCGDTVREVSFADKSFQYCPTCQTGGKVLADRRMSRLLK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgaactgcccgagatcgaagcgctggccgatcatctacggcgcaacgccgtgggc
ctgacggtcggccgcgtcgacatcgccgccctgtccgtcctgaagaccttcgacccgccg
atcagcgcgctgcacggccagaccgtggtcggggccgaccgctggggcaaatacctgggg
ctgcggacggacgacctctacctggtcgcccacttgtcccgggcgggctggttgcggtgg
tccgacacgctggccgcggcgccgctgcgccccggcaagggcccgatcgcgctgcgcgtg
cacctgggcacgcccggtgaggcgcccggcttcgacctcaccgaggccggcacccagaag
cggctggcggtgtggctggtaagcgacccgcagcagatcccacagatcgcctccctcggg
ccggacgcgctggacctcggccccgacgacctggcccgcgttctggcgggcaacaccggg
cggatcaagaccgtcatcaccgaccagaaggtgatcgccggtatcggcaacgcctacagc
gacgagatcttgcacgtcgcgaagatctcgccgttcgccaccgccggcaagctgtccgag
aagcagctcgccgcgctgcacgacgccatgatcaccgtgctcaccgacgcggtgagccga
tccgtcggcaagggcgcggccacgctcaagggcgagaagcgctccggattgcgcgtgcac
gcccgcacgggcctgccctgcccggtgtgcggggacaccgtgcgtgaagtgtcgttcgcg
gacaagtcttttcaatattgtccgacgtgtcagaccggaggcaaggtcctggccgaccgg
cggatgtcgcgtttgctgaagtag

DBGET integrated database retrieval system