KEGG   Mycobacterium indicus pranii: MIP_01565Help
Entry
MIP_01565         CDS       T02325                                 

Definition
(GenBank) Succinyl-CoA ligase [ADP-forming] subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mid  Mycobacterium indicus pranii
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MIP_01565
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MIP_01565
   00640 Propanoate metabolism
    MIP_01565
   00660 C5-Branched dibasic acid metabolism
    MIP_01565
Enzymes [BR:mid01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MIP_01565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1105205..1106368
Genome map
AA seq 387 aa AA seqDB search
MDLFEYQAKELFAKHNVPTTPGRVTDTAEGAREIATEIGRPVMVKAQVKVGGRGKAGGVK
YAATPEDAFEHAKNILGLDIKGHVVKKLLVAEASDIAEEYYISFLLDRANRTYLAMCSVE
GGMEIEEVAATKPERLAKVSVDAVKGVDLATARSIAEQGHLPAEVLDAAAITINKLWEVF
VAEDATLVEVNPLVRDPEDRILALDGKVTLDANADFRQPGHAEFEDRDATDPLELKAKEH
DLNYVKLDGQVGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGASAEVMAAGLD
VILNDKQVKSVFVNVFGGITSCDAVANGIVTALNMLGDEANKPLVVRLDGNNVDEGRRIL
AQANHPLVIQAETMDAGADKAAELANK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggatcttttcgagtatcaagcaaaagaattgttcgccaagcacaacgtaccgactacg
ccgggacgcgtgaccgacaccgccgagggcgctcgcgagatcgccaccgagatcggtcgt
ccggtgatggtcaaggcgcaggtgaaggtcggtggacgcggcaaggcgggcggcgtcaag
tacgcggcgacgcccgaggacgccttcgaacatgcgaagaacatcctcggtctcgacatc
aagggacacgtcgtcaagaagctgttggtcgccgaggccagcgacatcgccgaggagtac
tacatctcgttcctgctcgaccgcgccaaccgcacctacctggccatgtgctcggtcgag
ggcggcatggaaatcgaggaggtggcggcgaccaagcccgagcggctggccaaggtgtcg
gtggacgccgtcaagggtgtcgacctggcgaccgcgcgttccattgccgagcagggccac
ttgccggccgaggtgctcgacgccgccgcgatcaccatcaacaagctctgggaggtcttc
gtcgccgaggacgccacgctggtcgaggtcaatccgctggtgcgcgatcccgaagaccgg
atcctggcgctggacggcaaggtcaccctcgacgccaacgccgacttccggcagcccggc
cacgccgagttcgaggaccgcgacgccacggacccgctggaactcaaggccaaggagcac
gacctcaactacgtcaagctcgacggccaggtcggcatcatcggcaacggcgcgggcctg
gtgatgtccacgctcgacgtcgtcgcctacgccggcgaaaagcacggtggggtcaagccg
gccaacttcctggacatcggcggtggcgcgtcggccgaggtgatggccgcgggcctcgac
gtcatcctgaacgacaagcaggtcaagagcgtcttcgtgaacgtgtttggtggcatcacc
tcctgtgacgccgtcgcgaacggaatcgtgaccgcgctgaacatgctcggtgacgaagcg
aacaagccgctcgtggtccggctcgacggcaacaacgtcgatgagggccggcgcattctg
gcgcaagccaaccacccgctggtgatccaggccgagaccatggacgccggcgccgacaaa
gccgccgagctggcgaacaagtaa

DBGET integrated database retrieval system