KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_01565Help
Entry
MIP_01565         CDS       T02325                                 

Definition
(GenBank) Succinyl-CoA ligase [ADP-forming] subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
Pathway
mid00020  Citrate cycle (TCA cycle)
mid00640  Propanoate metabolism
mid00660  C5-Branched dibasic acid metabolism
mid01100  Metabolic pathways
mid01110  Biosynthesis of secondary metabolites
mid01120  Microbial metabolism in diverse environments
mid01130  Biosynthesis of antibiotics
mid01200  Carbon metabolism
Module
mid_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mid_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MIP_01565
   00640 Propanoate metabolism
    MIP_01565
   00660 C5-Branched dibasic acid metabolism
    MIP_01565
Enzymes [BR:mid01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MIP_01565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: AFS13081
UniProt: J9WCP2
Position
1105205..1106368
Genome map
AA seq 387 aa AA seqDB search
MDLFEYQAKELFAKHNVPTTPGRVTDTAEGAREIATEIGRPVMVKAQVKVGGRGKAGGVK
YAATPEDAFEHAKNILGLDIKGHVVKKLLVAEASDIAEEYYISFLLDRANRTYLAMCSVE
GGMEIEEVAATKPERLAKVSVDAVKGVDLATARSIAEQGHLPAEVLDAAAITINKLWEVF
VAEDATLVEVNPLVRDPEDRILALDGKVTLDANADFRQPGHAEFEDRDATDPLELKAKEH
DLNYVKLDGQVGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGASAEVMAAGLD
VILNDKQVKSVFVNVFGGITSCDAVANGIVTALNMLGDEANKPLVVRLDGNNVDEGRRIL
AQANHPLVIQAETMDAGADKAAELANK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggatcttttcgagtatcaagcaaaagaattgttcgccaagcacaacgtaccgactacg
ccgggacgcgtgaccgacaccgccgagggcgctcgcgagatcgccaccgagatcggtcgt
ccggtgatggtcaaggcgcaggtgaaggtcggtggacgcggcaaggcgggcggcgtcaag
tacgcggcgacgcccgaggacgccttcgaacatgcgaagaacatcctcggtctcgacatc
aagggacacgtcgtcaagaagctgttggtcgccgaggccagcgacatcgccgaggagtac
tacatctcgttcctgctcgaccgcgccaaccgcacctacctggccatgtgctcggtcgag
ggcggcatggaaatcgaggaggtggcggcgaccaagcccgagcggctggccaaggtgtcg
gtggacgccgtcaagggtgtcgacctggcgaccgcgcgttccattgccgagcagggccac
ttgccggccgaggtgctcgacgccgccgcgatcaccatcaacaagctctgggaggtcttc
gtcgccgaggacgccacgctggtcgaggtcaatccgctggtgcgcgatcccgaagaccgg
atcctggcgctggacggcaaggtcaccctcgacgccaacgccgacttccggcagcccggc
cacgccgagttcgaggaccgcgacgccacggacccgctggaactcaaggccaaggagcac
gacctcaactacgtcaagctcgacggccaggtcggcatcatcggcaacggcgcgggcctg
gtgatgtccacgctcgacgtcgtcgcctacgccggcgaaaagcacggtggggtcaagccg
gccaacttcctggacatcggcggtggcgcgtcggccgaggtgatggccgcgggcctcgac
gtcatcctgaacgacaagcaggtcaagagcgtcttcgtgaacgtgtttggtggcatcacc
tcctgtgacgccgtcgcgaacggaatcgtgaccgcgctgaacatgctcggtgacgaagcg
aacaagccgctcgtggtccggctcgacggcaacaacgtcgatgagggccggcgcattctg
gcgcaagccaaccacccgctggtgatccaggccgagaccatggacgccggcgccgacaaa
gccgccgagctggcgaacaagtaa

DBGET integrated database retrieval system