KEGG   Mycobacterium indicus pranii: MIP_01578Help
Entry
MIP_01578         CDS       T02325                                 

Definition
magnesium-chelatase subunit chlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mid  Mycobacterium indicus pranii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mid00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1115605..1116999
Genome map
AA seq 464 aa AA seqDB search
MVTSPSNLPRTVGELRAAGHRERGVKQEIRENLLTALADGPDSAAIWPGILGFDDTVLPQ
LERALIAGHDFVLLGERGQGKTRLLRALVGLLDEWTPVIAGAELGEHPFSPITPESIRKA
ATLGDDLPVEWKHRSERYTEKLATPDTSVADLVGDIDPIKVAEGRSLGDPETIAYGLIPR
AHRGIVAVNELPDLAERIQVSMLNVMEERDIQVRGYTLRLPLDVLVVASANPEDYTNRGR
IITPLKDRFGAEIRTHYPLELDAEVGVIAQEAHLSAQVPDYLMQIIARFARYLRESNSVD
QRSGVSARFAIAAAETVAAAARHRGAILGETDPVARVVDLGTVIDVLRGKLEFESGEEGR
EQAVLEHLLRRATADTASRVLGGIDVGSLVSAVEGGSAVTTGERVSAKDVLAAVPRLPVV
DKIADKLGARSEGERAAALELALEALYLAKRIDKVSEEGQTVYG
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtggtgacgtcaccgagcaacctgccccgcaccgtcggcgaactgcgcgccgccggtcac
cgtgaacggggagtcaagcaggaaatccgcgaaaatctgctgaccgcactggccgacggg
ccggacagcgcagccatctggcctggcattctgggattcgacgacaccgtcttgccccag
ctcgagcgggctttgatcgcgggtcacgacttcgtgctgctcggcgagcgcggccagggc
aaaacccggctgctgcgtgcgctggtcgggttgctcgatgagtggacgccggtgatcgcc
ggggccgaactgggggagcatccgttctcgccgatcacgccggagtcgatccgcaaggcc
gccaccctgggcgacgacctgccggtggagtggaagcaccgcagcgagcgctacaccgaa
aagctcgccacgcccgacaccagcgtcgccgacctggttggcgacatcgacccgatcaag
gtcgccgagggccgcagcctgggggaccccgagaccatcgcctacgggctgattccgcgc
gcgcaccgcggcatcgtcgcggtcaacgaacttcccgacctcgccgagcgcatccaggtg
tcgatgctcaacgtgatggaggagcgcgacatccaggtccgcggctacacgctgcgcctg
ccgctggacgtgttggtggtcgccagcgccaaccccgaggactacaccaaccgcgggcgc
atcatcaccccgctcaaggaccgcttcggcgcggagatccggacccactatccgctcgag
ctcgacgcggaagtcggggtgatcgcgcaggaggcgcacctgtcggcgcaggtgcccgac
tacctcatgcagatcatcgcccggttcgcccgctacctgcgggagtcgaattccgtcgac
caacgctcgggggtgtcggcgcggttcgccatcgccgccgccgagaccgtcgcggccgcc
gcccgccatcgcggcgcgatcctgggggagacggacccggtggcacgggtggtcgatctg
ggcaccgtgatcgacgtcctgcgcggcaagctggaattcgagtccggcgaggaaggccgc
gaacaggcggtgctcgaacacctgctgcgccgcgcgaccgcggacaccgcgtcgcgggtg
ctgggcggcatcgacgtcggatcgctggtgtcggcggtcgagggcgggtccgcggtgacg
acgggcgagcgggtgtcggcaaaggacgtgctggccgccgtcccgcgcctgccggtggtg
gacaagatcgcggacaagctgggcgcgcggtcggagggcgaacgcgccgccgcgctcgag
ctggcgctcgaggctttgtatctggccaagcgcatcgacaaggtgtccgaggaggggcaa
accgtctatggctaa

DBGET integrated database retrieval system