KEGG   Mycobacterium indicus pranii: MIP_01609Help
Entry
MIP_01609         CDS       T02325                                 

Definition
UTP--glucose-1-phosphate uridylyl transferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mid  Mycobacterium indicus pranii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MIP_01609
   00052 Galactose metabolism
    MIP_01609
   00500 Starch and sucrose metabolism
    MIP_01609
   00520 Amino sugar and nucleotide sugar metabolism
    MIP_01609
Enzymes [BR:mid01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MIP_01609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1136625..1137497
Genome map
AA seq 290 aa AA seqDB search
MPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAEAGAERLVIITSEGKDGVVAHF
VEDLVLESTLEERGKTAMLDKVRRAPRLIKVESVVQSEPLGLGHAIGCVESRLSDDENAI
AVLLPDDLVLPTGVLGTMSKVRAHHGGTVLCAIEVTPEEISAYGVFDVEPVPDDENPDVL
RVKSMVEKPKAEDAPSLFAAAGRYVLDRAIFDALRRTERGAGGEVQLTDGIALLIAEGHP
VHVVVHRGSRHDLGNPGGYLKAAVDFALDRDDYGPDLRQWLVARLGLAEQ
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgccgccggtctcggtacccgcttcttgccggcaaccaaaacggttcccaaggaa
ctgctgccggtggtcgataccccgggcatagagctggtggccgccgaagcggccgaagcc
ggcgccgaacggctggtgatcatcacctccgagggcaaggacggcgtcgtcgcgcatttc
gtcgaagacctcgtactggaaagcacgctggaggagcgcggcaagaccgcgatgctcgac
aaggtccgccgcgcgccgcgactgatcaaggtcgagtccgtcgtgcagagcgaaccgctg
gggctcggccatgcgatcgggtgcgtggaatcgcggctgtccgacgacgagaacgcgatc
gcggtgctgctgcccgacgacctggtgttaccgaccggcgtgctgggcacgatgtcgaag
gtgcgggcccaccacggcggcaccgtgttgtgcgcgatcgaggtcacccccgaagagatc
agcgcgtacggcgttttcgacgtcgagccggtgcccgacgatgagaaccccgacgtgctg
cgggtcaagagcatggtcgagaagcccaaggccgaggacgcgccgtcgctgttcgccgcg
gcgggccgatatgtgctcgaccgcgccatctttgacgcgttgcgccgcaccgagcgcggg
gccggtggcgaagtgcaactcaccgacggcatcgccctgctgatcgcggagggccacccg
gtgcatgtggtcgtgcaccgcggatctcgacacgacttgggaaatcctggcggctacctc
aaggctgcggttgactttgcattggatcgtgacgactacggcccggatttgcggcaatgg
ttggtggcgcgattgggcctggccgagcagtag

DBGET integrated database retrieval system