KEGG   Mycobacterium indicus pranii: MIP_01675Help
Entry
MIP_01675         CDS       T02325                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mid  Mycobacterium indicus pranii
Pathway
mid00521  Streptomycin biosynthesis
mid00523  Polyketide sugar unit biosynthesis
mid01130  Biosynthesis of antibiotics
Module
mid_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    MIP_01675
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MIP_01675
Enzymes [BR:mid01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     MIP_01675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: AFS13156
UniProt: J9WCW8
Position
complement(1186301..1186873)
Genome map
AA seq 190 aa AA seqDB search
MKYTPTKVAGVTIIDFELNHDHRGFSSRSFSARDFANHGLDFEVAQTNIYFNYTRGTVRG
LYRRVPPHAEAKLVRCTRGAIAAVAVDVRPDSLTYGDHVMVQLSADDQRTLFLPPYVAYG
FQTQVDDTEVTFHVSGQYAMADEQGIRWDDPEFGISWPIPVTVISEQDASWPSRKSRLAP
VEQVASCVSR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtacacgcccaccaaggtcgccggggtgacaatcatcgacttcgaactcaaccac
gaccatcgcgggttctcctcacgttcgttctccgcccgtgacttcgccaaccatgggctg
gatttcgaagtcgcgcagacgaatatctacttcaactacacccgcggcaccgtgcgtggc
ctgtaccgccgggtgccgccgcacgccgaggcgaaactggtccgttgcacgcgcggtgcc
atcgccgccgtcgcggtcgacgtccgccccgactcgctgacctacggcgaccacgtgatg
gtgcagttgagcgccgacgaccaacgcacgctgttcttgcccccgtatgtcgcttatggc
ttccagacgcaggtcgacgacaccgaggtcacctttcacgtcagcggccagtacgcgatg
gccgacgagcaggggatccgctgggacgaccccgaattcggaatctcatggccgataccg
gtcaccgtcatctccgagcaagacgcgagctggccctcgcgcaaatccagattggcacca
gtcgaacaggtggcatcatgcgtcagtcggtga

DBGET integrated database retrieval system