KEGG   Mycobacterium indicus pranii: MIP_02195Help
Entry
MIP_02195         CDS       T02325                                 

Definition
Cob
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
mid  Mycobacterium indicus pranii
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mid00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:mid00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1563625..1564878
Genome map
AA seq 417 aa AA seqDB search
MAERFVVTGGNRLSGEVAVGGAKNSVLKLMAAALLAEGTSTITNCPDILDVPLMAEVLRG
LGATVELDGDVARITSPDEPKYDADFAAVRQFRASVCVLGPLVGRCKRARVALPGGDAIG
SRPLDMHQAGLRQLGAQCNIEHGCVVAQADTLRGAEIQLEFPSVGATENILMAAVVAEGV
TTIHNAAREPDVVDLCTMLNQMGAQVEGAGSPTMTITGVPRLHPTEHRVIGDRIVAATWG
IAAAMTRGDISVTGVDPAHLQVVLHKLHDAGATVTQTESSFRVAQYERPKAVNVATLPFP
GFPTDLQPMAIALASIADGTSMITENVFEARFRFVEEMIRLGADARTDGHHAVVRGLPQL
SSAPVWCSDIRAGAGLVLAGLVADGDTEVHDVFHIDRGYPLFVENLAILGAEIERVE
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagcgattcgtggtgaccggcggcaaccggttgtccggtgaagtcgcggtgggg
ggcgcaaagaacagcgtgctcaagctgatggccgcggcgttgttggccgaaggcaccagc
accatcaccaattgccccgacatcctcgacgtgccgctgatggccgaggtgctgcgcggc
ctcggggcaaccgtcgaactcgacggtgacgtcgcccggatcacctcgcccgacgagccg
aaatacgatgccgacttcgcggcggtgcgccagttccgggcttcggtgtgcgtactgggc
ccactggtcggtcggtgtaagcgggcccgcgtcgcccttcccggcggagacgcgatcggc
tcgcggccgctggacatgcaccaggccggcctgcgccagctgggcgcgcaatgcaacatc
gaacacggatgcgtcgtggcgcaggctgatacgttgcgcggcgcggagattcagttggag
tttccgtcggtgggcgccaccgagaacatcctgatggccgcggtcgtggccgaaggcgtg
accacgatccacaacgccgcgcgcgaacccgacgtcgtcgacctctgcacgatgttgaac
cagatgggcgcgcaggtcgaaggcgccggttcgccgacgatgaccatcaccggcgtcccg
cgactgcacccgaccgaacaccgcgtcatcggggatcgcatcgtcgccgccacgtggggc
atcgccgccgcgatgacccgcggagacatctcggtcaccggtgtcgacccggcgcacctg
caggtggtgctgcacaagctgcacgacgccggcgccaccgtcacccaaacggaaagcagc
ttccgggtggcccagtacgagcgcccgaaggccgtcaatgtcgcgaccctgccgtttccc
gggtttcccaccgacctgcagcccatggcgatcgcgctggcgtcgatcgccgatggcacg
tcgatgatcaccgagaacgtattcgaggcgcgctttcgtttcgtcgaggaaatgatccgg
ctgggcgccgacgcccgcaccgacgggcaccatgccgtcgtgcgtgggctgccgcaattg
tcgagcgcgccggtgtggtgttcggacatccgggccggcgccggcctggtgttggcgggg
ctcgtcgccgacggcgacaccgaggttcacgacgtcttccacatcgatcgcggctacccg
ttgttcgtggaaaacctggcgattttgggagcggagatcgagcgggtagagtaa

DBGET integrated database retrieval system