KEGG   Mycobacterium indicus pranii: MIP_02220Help
Entry
MIP_02220         CDS       T02325                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mid  Mycobacterium indicus pranii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MIP_02220
Enzymes [BR:mid01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     MIP_02220
Exosome [BR:mid04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MIP_02220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1583629..1585851)
Genome map
AA seq 740 aa AA seqDB search
MKRTGGERDMSQADQLARTHLAPDPADLSRLVAGTHHNPHGVLGAHEYGDHTVIRAYRPH
AVEVVAIVGDDRFPMQHVESGLFAVALPFTNLIDYRLQITYEGADPYVVADAYRFLPTLG
EVDLHLFAEGRHERLWEVLGAHPRSFTTADGVVNGVSFAVWAPNAKGVSLIGEFNGWTGN
DAPMRVLGSSGVWELFWPGFPLEGLYKFRVHGADGVVTERADPMAFATEVPPHTASRVTR
SKYTWEDADWMTQRAGRNPVFEPMSTYEVHLGSWRPGLNYRQLARELTDYVVEHGFTHVE
LLPVAEHPFAGSWGYQVTSYYAPTSRFGTPDEFRALVDALHQAGIGVLVDWVPAHFPKDA
WALARFDGTPLYEHSDPQRGEQLDWGTYVFDFGRREVRNFLVANALFWLEEFHIDGLRVD
AVASMLYLDYSRPEGGWTPNIYGGRENLEAVQFLQEMNATAHKSAPGIVTIAEESTSWPG
VTRPTNLGGLGFSMKWNMGWMHDTLDYISRDPIYRSYHHHEMTFSMLYAFSENYVLPISH
DEVVHGKGTLWGRMPGNNHVKAAGLRSLLAYQWAHPGKQLLFMGQEFGQRAEWSEERGLD
WWQLDEQGFSNGVLRMVRDINNIYRSHPALWSQDTVPDGYSWIDANDSGNNVLSFLRYGK
DGSVMACVFNFAGAEHGGYRLGLPSAGRWREVLNTDATVYNGSGVGNMGGVDATEDPWHG
RPASAVLVLPPTSALWLEPE
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggaccggaggcgaaagggacatgagccaagccgaccaactcgctcggacgcac
ctggcgcccgaccccgccgacctgtcgcgcctggtcgccggcacgcaccacaacccgcac
ggcgtgctgggggcccacgaatacggcgaccacaccgtcattcgggcgtaccggccccac
gcggtcgaggtcgtcgcgatcgtcggcgacgaccgattcccgatgcagcacgtcgagtcc
gggctgttcgccgtggcgctgccgttcaccaacctgatcgactatcggctccagatcacc
tacgagggcgccgacccctacgtcgtcgccgacgcctaccgtttcctgcccaccctcggc
gaggtcgaccttcatctattcgccgaagggcgccacgagcgcctctgggaagtccttggc
gcgcatcctcgctcgttcaccacggccgacggcgtggtcaacggggtgtcgttcgcagtg
tgggcgcccaacgccaagggcgtcagcctgatcggcgagttcaacggctggaccggcaac
gacgccccgatgcgggtgttgggctcctcgggcgtgtgggagctgttctggcccggcttc
ccgctcgaggggctgtacaagtttcgcgttcatggcgccgacggagtggtcaccgaacgc
gccgaccccatggccttcgccaccgaggtgccgccgcacacggcctcccgggtgacgcgc
agcaagtacacctgggaagacgcggactggatgacgcagcgcgccgggcgcaacccggtg
ttcgagccgatgagcacctacgaggttcacctgggttcatggcgacccgggctcaactac
cgccagttggcccgcgagctgacggattacgttgtggagcacggattcacccacgtcgag
ctgctcccggtcgccgaacatcccttcgccggatcctggggataccaggtgacgtcgtac
tacgccccgacgtcccggttcggcaccccggacgaattccgggccctggtcgacgccctg
caccaggccggtatcggcgtgctggtggactgggtgccggcacacttcccgaaggacgcg
tgggcgctggcccgcttcgacggcaccccgctttacgaacattccgacccgcaacgcggt
gagcaactcgactggggcacctacgttttcgacttcggtcgccgtgaggtacgcaacttc
ctggtggccaacgccttgttctggctcgaagaatttcacatcgatggactacgtgtggac
gcggtcgcgtcgatgctgtacctggattactcccgccccgaaggcggctggacgccgaac
atctacggcgggcgggagaacttggaggcggtccagttcctgcaggagatgaacgccacg
gcgcacaagagcgccccgggcatcgtcaccatcgccgaggagtcgacctcctggcccggg
gtcacccggccgacaaaccttggcggcctgggcttttcaatgaagtggaacatgggctgg
atgcatgacacgctcgactacatcagccgcgatccgatctatcggagctatcaccaccac
gagatgacgttctcgatgctttatgcgttcagcgagaactacgtgctgccgatcagccat
gacgaggtggtccacggcaagggaacgctatggggacgcatgccgggcaacaatcacgtc
aaggccgccggcctgcgcagcctgctcgcctaccagtgggcgcacccgggcaagcaattg
ctgttcatgggccaggaattcggccagcgcgccgagtggtccgaagagcgcggtctggat
tggtggcagctcgacgagcagggattctccaacggcgtcctgcgcatggtgcgcgacatc
aacaacatctaccgcagccacccggcgctgtggagccaagacaccgtgcccgacggctac
tcctggatcgacgccaacgactcgggcaacaacgtcttgagcttcctgcgttacggcaag
gacggctcggtgatggcgtgcgtgttcaatttcgccggtgccgagcacggcggctaccgg
ctgggcctgccgtcggcggggcggtggcgcgaggtgctcaacaccgacgccaccgtctac
aacggttcgggggtcgggaacatgggcggtgtcgatgccaccgaagacccgtggcacggg
cgcccggcctcggcggtgctggtgttgccgcccacgtcggcgctgtggctggaaccggag
tag

DBGET integrated database retrieval system