KEGG   Mycobacterium indicus pranii: MIP_02541Help
Entry
MIP_02541         CDS       T02325                                 

Definition
Kinase, pfkB family protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mid  Mycobacterium indicus pranii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MIP_02541
Enzymes [BR:mid01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MIP_02541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1841608..1842459)
Genome map
AA seq 283 aa AA seqDB search
MNIDLSLGVGALPRPGETVLASSMTQAPGGKGGNQAVAAARAGARVQFVGAVGDDPAAEQ
LRAHLRANGVGLDGAVEIPGPSGTAVVVVDAYAENTIVVAPGANGRFTLTDDRARGVVAD
CDVMLTQLEIPVDTAIAAAQHARSAGAVVVVNASPAGQDPASLGELAAAADVVITNEEEA
NEWPWRPAHLVVTLGSRGARYAGADGEYSVPSPAVDAVDTTGAGDVFAGVLAANWPPNPG
SAGERRLALRRACAAGALATLVPGAGDCAPDAEAIDKALQNAS
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatcgatctgtcgctgggcgtcggcgccctcccgcggcccggcgaaacggtgttg
gcgtcgtcgatgacacaagcccccggcggcaagggcggcaaccaggcggtggcagccgcg
cgcgcgggcgcgcgcgtgcagttcgtcggggccgtcggcgacgacccggccgccgagcag
ttgcgcgcccacctgcgggccaacggtgtcgggctcgacggggccgtggaaatccccggg
cccagcggcaccgccgtcgtcgtcgtcgatgcctacgccgagaacaccatcgtcgtggcg
ccgggagccaacgggcggttcacgctgaccgatgaccgcgcgcgcggcgtggtcgcagac
tgcgatgtgatgttgacccagctggagattccggtcgacacggcgatcgcggcggcgcaa
cacgcccggtcggccggagcggtcgtcgtcgtgaacgcctcaccggccggccaggatccc
gcttcgctgggcgagctggcggccgccgccgacgtggtgatcaccaacgaagaggaggcc
aacgaatggccttggcgcccagcacacctggtggtcaccctgggttcgcgcggcgcgcgc
tacgccggcgccgacggcgagtactcggtgccctcccccgcggtggacgcggtggacacc
accggcgccggcgacgtgttcgccggtgtgctggccgcgaactggccgcccaatcccggc
tcggcgggtgagcggcgactcgcgctacgccgcgcctgcgcggccggcgcgctggcgacg
ctggttcccggcgccggtgattgcgcaccggacgccgaggcgatcgacaaggcgcttcag
aacgcgtcctag

DBGET integrated database retrieval system