KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_03148Help
Entry
MIP_03148         CDS       T02325                                 

Definition
(GenBank) Dihydrolipoyllysine-residue succinyl transferase component of 2-oxoglutarat dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
Pathway
mid00020  Citrate cycle (TCA cycle)
mid00310  Lysine degradation
mid01100  Metabolic pathways
mid01110  Biosynthesis of secondary metabolites
mid01120  Microbial metabolism in diverse environments
mid01130  Biosynthesis of antibiotics
mid01200  Carbon metabolism
Module
mid_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mid_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MIP_03148
  Amino acid metabolism
   00310 Lysine degradation
    MIP_03148
Enzymes [BR:mid01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MIP_03148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H TonB_N Trypan_PARP
Motif
Other DBs
NCBI-ProteinID: AFS14159
UniProt: J9WAE1
Position
complement(2305673..2307466)
Genome map
AA seq 597 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDTVELDEPLVEVSTDKVDTEIPSPAAGVLTKIV
AQEDDTVEVGGELAVIGDEDGGSQAPSQQEPQAQSAPPAQPEAQPEPEPQPQAQPEPQPA
QQSSGGGDATPVLMPELGESVTEGTVTRWLKKVGDSVQVDDALVEVSTDKVDTEIPSPVA
GVLISITAEEDATVPVGGELARIGSGSEAAAPAAPQPPPAPKAEPKPEPAPQPQPQPQPQ
PQAQPKPEPTPAPAPQPKAAPEPKAQPAQAQPADASGDGTPYVTPLVRKLAAENNIDLSS
VTGTGVGGRIRKQDVLAAAERKQQADKAPAAAAAPTPAAGEARKAAPAPTPAPALAHLRG
TTQKASRIRQITANKTRESLQATAQLTQTHEVDMTRLVGLRARAKAAFAEREGVNLTFLP
FIARAVIDALKIHPNVNASYNEETKEITYFDAEHLGFAVDTEQGLLSPVVHNAGDLSLAG
LARAIADIAARARSGNLKPDELSGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKR
PRVIVDEFGNESIGVRSICYLPLTYDHRLIDGADAGRFLTTIKHRLEEGAFEADLGL
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgccggcactcggtgagagcgtcaccgaggggacggtcacc
cgctggctcaagcaggaaggcgacacggtcgaactcgacgagccgctcgtcgaggtgtcg
accgacaaggtcgacaccgaaatcccgtcgccggccgcgggtgtgctgaccaagatcgtc
gcccaggaagacgacaccgtcgaggtcggcggcgagctggccgtgatcggcgacgaggac
ggcggatcccaggcgccgagccagcaagagccgcaggcgcagtcggcgccccccgcccag
cccgaggcgcaacccgagcccgagccgcagccccaggcccagcccgagccgcagccggcc
cagcagagctccggcggcggcgacgccaccccggtgctgatgcccgaactgggtgagtcg
gtgaccgagggcaccgtgacccgctggctcaagaaggtcggcgattcggtccaggtcgac
gacgcgcttgtcgaggtgtccaccgacaaggtggacaccgagatcccgtcgccggtggcc
ggtgtgctgatcagcatcaccgccgaggaagacgccaccgtgcccgtcggcggcgagctg
gcccgcatcggcagcggttccgaggccgccgcccccgccgcgccgcagccgccgcccgcg
cccaaggccgaacccaagccggaacccgcgccacaaccgcaaccacaaccacagccccag
ccccaggcgcagccgaagcccgaaccgacgccggcccccgcaccgcaaccgaaggcggca
cccgagccgaaagcccaacccgcacaggcccagccggcggacgcgagcggcgacggcacc
ccctacgtgacgccgctggtgcgaaaactggccgccgagaacaacatcgacctcagttcg
gtcaccggcaccggagtgggcggccgcatccgcaagcaagacgtgctggcggccgccgag
cgcaagcagcaggccgacaaggcgcccgccgccgctgctgctcccacccccgctgccggc
gaggcccgcaaggccgctcccgcgcccaccccggcgccggcgctggcgcacctgcgcggc
accacccagaaggccagccggatccgtcagatcaccgccaacaagacgcgcgaatccctg
caggccacagcccaactcacccagacccacgaggtcgacatgaccaggctggtcgggttg
cgggccagggccaaggcggcgttcgccgaacgcgaaggcgtcaacctgaccttcctgccg
ttcatcgcccgcgcggtgatcgacgccctcaagatccacccgaacgtgaacgcgagctac
aacgaggaaaccaaggagatcacctacttcgacgccgagcacctcggcttcgcggtcgac
accgaacagggtctgctctcccccgtcgtgcacaacgccggcgacctgtcgctggccggg
ctggccagggcgatcgccgacatcgccgcgcgcgcccgctcgggcaacctgaaacccgac
gagctctcgggcggcacgttcacgatcaccaacatcggcagccagggggcgctgttcgac
accccgatcctggtcccgccgcaggccgcgatgctgggcaccggcgccatcgtcaaacgc
ccccgggtgatcgtcgacgaattcggcaacgaatcgatcggtgtccgatcgatctgctac
ctgccgctgacctatgaccaccggctgatcgacggcgcggatgccgggcggttcctgacc
accatcaagcaccggctcgaagagggagcgttcgaggccgacctcgggctctga

DBGET integrated database retrieval system