KEGG   Mycobacterium indicus pranii: MIP_03219Help
Entry
MIP_03219         CDS       T02325                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--26-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mid  Mycobacterium indicus pranii
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    MIP_03219
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MIP_03219
Enzymes [BR:mid01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     MIP_03219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2364068..2365651
Genome map
AA seq 527 aa AA seqDB search
MSWPIMADGGGDGVSVPSALRPSAAAGVRLPALAADIGAAPAGDRAVPNLPVTGVTLRAQ
EVRPGDLFAALPGSTTHGARYAGDAIERGAVAVLTDAGGVAEMGALGQSVPVLVHPDPRG
VLGGLAATVYGNPSERVTVVGVTGTSGKTTTTYLIESALRAAGHTAGLIGTIGIRIDGAD
IPSALTTPEAPALQAMLAAMAEQGVDTVVMEVSSHALTLGRVDGTRFAVGGFTNLSRDHL
DFHPTMADYFEAKAMLFDPGSPLRARRVVVCVDDDAGRAMAARAGDAITVSAEGRPAHWR
ATDVAPMGAAGQRFTAIDPAGARHQLGVRLPGHYNVANCLVALAILDAVGVSPEQASTGL
LQARVPGRMEEIDAGQDFLALVDYAHKPGALRAVLTTLARPDRRLAVVFGAGGERDPGKR
APMGATAAELADLVVVTDDNPRGEDPASIRREILAGATESGCAADIVEIADRRDAIRHAV
AWAGPGDVVLIAGKGHETGQSAGGHIRPFDDRVELAQALRDLDGAPR
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
gtgtcatggccgatcatggctgacggaggtggtgacggggtgtcggtgcccagtgcgctg
cggcccagcgccgcagcgggcgtgcgcttgccggcgttggcggctgacatcggagccgcg
ccggccggcgatcgggccgtcccgaacctgccggtcaccggggtcacgctgcgcgcccag
gaggtgcggcccggcgatctgttcgccgcgctgcccggttccaccacccacggcgcgcgt
tacgccggcgacgcgatcgaacgcggcgcggtcgccgtgctcaccgacgccggcggggtc
gccgagatgggcgccctagggcaatccgtgccggtcctcgttcacccggacccccgcggt
gtgctcggcgggctggccgccacggtgtacgggaacccgtccgagcgggtgacggtcgtc
ggcgtcaccggcacgtccggcaagaccaccacgacgtatctcatcgagtccgcactgcgc
gccgccggccacaccgccgggctgatcggcaccatcgggatccgcatcgacggcgccgac
attcccagcgcgctgaccaccccggaggcccccgccctgcaggcaatgctggcggcgatg
gccgaacagggggtggacaccgtcgtcatggaggtctccagtcacgccctgacgctgggc
cgcgtggacggaacccggttcgcggtgggcggtttcaccaacctgtcccgcgaccacctc
gacttccacccgacgatggccgactacttcgaggccaaggcgatgctcttcgacccgggc
tccccgctgcgggcccggcgcgtcgtggtctgcgtcgacgacgacgccgggcgcgccatg
gccgcccgcgccggcgacgcgatcaccgtcagcgccgagggccggcccgcccactggcgc
gccaccgacgtggccccgatgggcgccgcgggacaacggttcaccgccatcgatcccgcc
ggagcgcgccatcagctgggtgttcggctgcccggccattacaacgtcgccaattgcctt
gtcgcactggctattctggacgcggtcggggtgtccccggagcaggcgtcgacgggcctg
ctacaggcccgcgtgccgggacgcatggaggagatcgacgccggccaggacttcctggcg
ctggtcgactacgcccacaaaccgggcgcgttgcgcgcggtgctgaccacgctggcgcgt
ccggatcgccggctggccgtggtgttcggcgccggcggcgaacgcgacccgggcaaacgg
gcgccgatgggcgcgacggcggccgagctggccgatctggtcgtcgtcaccgacgacaac
ccgcgcggtgaggacccggcgtcgattcgtcgcgaaatcctcgccggggcgaccgaaagc
ggttgtgcggcagacattgtcgagatcgccgaccgccgcgacgcgatcaggcacgccgtc
gcctgggcgggcccgggcgacgtcgtgctgatcgccggcaagggccacgaaaccggccag
agcgccggcgggcacatccgccccttcgacgaccgggtcgagctggcgcaggcgctgcgg
gacctcgacggggcaccgcgatga

  All links  
No link information was found.   
DBGET integrated database retrieval system