KEGG   Mycobacterium indicus pranii: MIP_03653Help
Entry
MIP_03653         CDS       T02325                                 

Definition
Isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mid  Mycobacterium indicus pranii
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MIP_03653
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MIP_03653
Enzymes [BR:mid01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     MIP_03653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2693957..2696245)
Genome map
AA seq 762 aa AA seqDB search
MAIIDKDTQVRPSFDDEVAATQQYFDDPRFSRITRLYTARQVAEQRGTIPTDYTVARNAA
AAFYERLRELFAQKKSITTFGPYSPGQAVAMKRMGIEGIYLGGWATSAKGSTTEDPGPDL
ASYPLSQVPDDAAVLVRALLTADRNQQYQRLQMSEKQRAAAPVYDYRPFIIADADTGHGG
DPHVRNLIRRFVEVGVPGYHIEDQRPGTKKCGHQGGKVLVPSDEQIKRLNTARFQLDIMK
VPGIIVARTDAEAANLLDSRADERDQPFLLGATNLKIPSYKSCFLALVRRFYELGVKDLN
GHLLYALPEGEYAEATAWLERQGIQGLVSDAVNAWREDGQQSIDDLFDQVESRFVAAWED
DAGLMTYGEAVADVLAFAASEGEPADMSAEEWREFAATASLYSARAKAKELGVDPGWDCE
LSKTPEGYYQIRGGIPYAIAKSLAAAPFADLLWMETKTADLDDARQFADAIHAKFPDQML
AYNLSPSFNWDTTGMTDEQMKQFPEELGKMGFVFNFITYGGHQIDGVAAEEFATSLQQDG
MLALARLQRKMRLVESPYRTPQTLVGGPRSDAALTASSGRTATTKSMGEGSTQHQHLVQT
EVPKKLLEEWLAMWSENYDLGEKLRVQLRPRRAGSDVLELGIYGNDDEQLANVVVDPIKD
RHGRSILQVRDQNTFAEKLRQKRLMTLIHLWLVHRFKADGVIYVTPTEDNLYQTSKMKSH
GIFSEVYQEVGEIIVAEVNQPRIAELLKPDRVALRKLITKEG
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcatcgacaaggacacacaagtccggccatcgttcgacgacgaggtcgctgcc
acgcagcaatacttcgacgatccgcgcttttcccggatcacccgcctgtacaccgcccgc
caggtggccgagcagcgcggcaccatcccgaccgactacaccgtggcacgaaacgcggcg
gcggccttctacgagcggttgcgcgagctgttcgcccagaagaagagcatcacgacgttc
ggcccgtactcgcccggccaggcggtcgcgatgaagcggatgggcatcgaggggatctat
ctgggcggctgggccacctcggccaaggggtccaccaccgaagatcccggacccgacctc
gccagctacccgctgagccaggtgcccgacgacgccgcggtgctggtgcgcgccctgctg
accgccgaccgcaaccagcaataccagcgcctgcagatgagcgaaaagcagcgcgccgcg
gcccccgtctacgactaccggccgttcatcatcgccgacgctgataccggccacggcggt
gacccgcacgtgcgcaacctgatccgccggttcgtcgaggtcggcgtgcccggctaccac
atcgaggaccagcgccccggcaccaagaagtgcggccatcagggcggcaaggtgttggtg
ccgtccgacgaacagatcaaacggctcaacaccgcgcgcttccagctcgacatcatgaag
gtgccgggcatcatcgtcgcgcgcaccgacgccgaggccgccaacctgctggacagccgg
gccgacgagcgtgaccagccgttcctgctcggagccaccaacctcaagatcccgtcgtac
aagtcgtgcttcctggcgttggtgcgtcgcttctacgagctgggcgtcaaagacctcaac
ggccacctgctgtacgcgctgcccgaaggagagtacgccgaggccacagcttggcttgag
cgccaagggatccagggcctggtctccgacgccgtcaacgcctggcgcgaggacggtcag
cagtcgatcgacgacctgttcgaccaagtcgagtcgcggttcgtggcggcctgggaggac
gacgccggcctgatgacctacggcgaggccgtcgccgatgtgctcgcgttcgccgccagc
gagggcgaaccggccgatatgagcgccgaggagtggcgagagttcgccgcgaccgcctcg
ctctactcggccagggccaaggcgaaggagttgggcgtcgaccccggttgggactgcgaa
ctctcgaagacgcccgagggctactaccagatccgcggcggcatcccgtacgccatcgcc
aaatcgctggcggccgcgccgttcgccgacctcttgtggatggagaccaaaaccgccgac
ctggacgacgcccggcagttcgccgacgccatccacgccaagttccccgaccagatgctg
gcctacaatctgtccccgtcgttcaactgggacaccaccggcatgaccgatgagcagatg
aagcagttccccgaggaactgggcaagatgggtttcgtcttcaacttcatcacctacggc
ggacaccagatcgacggcgtcgccgccgaggagttcgccacctcgctgcaacaggacggc
atgctggcgctggcccgcctgcagcgcaagatgcgcctggtcgaatctccttaccgcaca
ccgcaaaccctcgtcgggggaccgcgcagtgacgccgcgctcacggcctcctcgggccgc
accgccaccaccaagtcgatgggcgaaggctcgacccagcaccagcacctggtgcagacc
gaggtgccgaagaagctgctcgaggagtggctggcgatgtggagcgagaactacgacctc
ggcgagaaactgcgggtgcaactgcggccccgccgggccggctcggacgtgctcgaactc
ggcatctacggcaacgacgacgagcagctggccaacgtggtcgtcgacccgatcaaggac
cggcacggccgcagcatccttcaggtgcgcgaccagaacaccttcgcggagaagctccgg
cagaagcggctgatgaccttgatccacctctggctggtgcaccgcttcaaggccgacggg
gtgatctatgtgacgccgaccgaggacaacctctatcagacctcgaagatgaaatcccac
ggcatcttcagcgaggtctaccaggaggtcggcgagatcatcgtcgccgaggtgaatcag
ccccgcatcgccgaactgctcaagcccgaccgcgtggcgctgcgcaagctgatcaccaag
gaggggtag

DBGET integrated database retrieval system