KEGG   Mycobacterium indicus pranii: MIP_03852Help
Entry
MIP_03852         CDS       T02325                                 

Definition
4-alpha-glucano transferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mid  Mycobacterium indicus pranii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MIP_03852
Enzymes [BR:mid01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     MIP_03852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2827136..2829304)
Genome map
AA seq 722 aa AA seqDB search
MTELAPSLIELARRYGIATEYEDWSGARVRVSETTLKAVLVALGVAADNEQERNVALTAK
LRSHWARRLPATIVGRTGEQIRFWAHVTHGAPAEVWLALEDGTVRGDVAQVDNFTPPFDL
DGRWVGEASFLLPTDLPLGYHRVHLRSGDSETSTALIVTPDWLGLPERLGNRRAWGLAVQ
LYSVRSRRSWGVGDLTDLTDLAVWSASRHGADYLLVNPLHAAAPPGPKGRMEPSPYLPTS
RRFVNPIYLRVEAIPEFADLGKRSRVRRLRADVQERAGRVDTIDRDSSWAAKRAALKLLH
EEPRSAGRELSYAAFRDREGRALDDFATWCALAEKYGDDWHCWPEALQHPDASGVADFVE
KHFDTVDFHRWLQWQIDEQLAAAQSQAIRAGMSLGIMGDLAVGVHPNGADTWALQDVMAL
GVTAGAPPDEFNQLGQDWSQPPWRPDRLDEHEYRPFRALIRAVLRHAGGVRIDHIIGLFR
LWWIPRGASPTEGTYVRYDHEAMIGIVALEAHRAGAVVVGEDLGTVEPWVRDYLLLRGLL
GTSILWFELDRDGNGGPLPAERWREYCLSSVTTHDLPPTAGYLAGDHVRLRDSLGLLTRP
VTEELESDRAELAAWLAELRRVGLLEDGDDDPERVVVALYRYLGRTPSRLLGVALTDAVG
DRRTQNQPGTTDEYPNWRVPLTGPNGRDVMLEDVFTDPRAATLAEAVRAAVAPSESREGA
TR
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaactcgcgccgtcgctgatcgaactcgcccggaggtacggcatcgcgacggag
tacgaggactggagcggcgcgcgggtgcgagtttccgaaacgacgctgaaggccgtgctg
gtcgcgctcggcgtcgcggccgacaacgaacaggaacgcaacgtcgcgctgaccgccaag
ctgcggtcgcactgggcgcggcggctgccggcgaccatcgtcgggcgcaccggtgagcag
atccggttttgggcccacgtcacccacggtgctcccgccgaggtgtggttggcgctcgag
gacggcacggtgcgcggcgacgtcgcgcaggtcgacaatttcaccccgccgttcgacctg
gacggacgctgggtcggcgaggccagcttcctgctgcccaccgacctgccgctgggttat
caccgggtgcacctgcgttccggggactccgagaccagcaccgcgctgatcgtgacgccg
gattggctcgggctgccggagcggctcggcaaccgtcgcgcctggggcctggccgttcag
ctctacagcgtgcggtcccggcggtcctggggcgtcggggatctcaccgatctgaccgac
ctcgcggtgtggtcggcgtcgcgccacggcgccgattacctcctggtcaatccgctgcat
gcggcggcgcctccgggtccgaagggccggatggagccgtcgccgtacctgccgacgtcg
cggcgcttcgtcaatccgatttatcttcgcgtcgaggcgatccccgaattcgccgacctg
ggcaagcgcagccgggtccgccggctgcgcgcggacgtccaggagcgcgccggccgcgtc
gacaccatcgaccgcgacagctcgtgggcggccaaacgggccgccctcaagctgctgcac
gaggaaccgcggtcggcgggccgggagctgtcctacgcggcgttccgcgaccgggagggc
cgcgcgctcgacgacttcgcgacctggtgcgcgctggccgaaaaatacggcgatgactgg
cattgttggcccgaagcgctgcaacatcccgacgcgtccggggtcgcagactttgtcgaa
aaacattttgacaccgtcgatttccaccgctggttgcaatggcaaatcgacgagcagctc
gccgcggcccagtcccaggcgatccgggccggaatgtcgttgggcatcatgggagacctg
gccgtcggcgtgcaccccaacggcgccgacacctgggcgctgcaggatgtgatggcgctg
ggcgtgaccgccggagcgccaccggacgagttcaatcagctcggccaggactggtcgcag
ccgccgtggcggccggaccgactggacgagcacgagtaccggccatttcgcgcgttgatc
cgcgcggtgctgcggcatgccggcggggtgcgcatcgaccacatcatcgggttgttccgg
ctctggtggatcccgcggggcgcgtcacccaccgagggcacctacgtgcgctacgaccac
gaagccatgatcggcatcgtcgccctggaggcgcatcgggcgggcgcggtggtggtgggc
gaggatctcgggacggtcgagccgtgggtgcgggattacctcctgttacgcggcttgctg
ggcacctcgatcctctggttcgagttggatcgcgacgggaacggcggcccactgccggcc
gagcgctggcgggagtactgcctgtcctcggtcaccacccacgacctgccgccgaccgcc
ggctacctggcgggcgaccatgtgcggctgcgcgattcgctgggattgctgacccggccc
gtcaccgaggagctcgagtccgaccgtgccgagttggcggcgtggctggccgagttgcgg
cgggtgggtctgctcgaggacggcgacgacgacccggagcgggtcgtcgtggcgctgtac
cggtatctgggcaggacaccgtcgcggctgctcggggtggcgttgaccgatgccgtcggt
gatcgccgcacccagaaccagcccggcaccacggacgaataccccaactggcgggtcccg
ctgaccggcccgaacgggcgcgacgtgatgctcgaagacgtcttcaccgatccccgggcc
gccacgctggccgaggccgtgcgcgcggcggtcgcaccctcagaaagcagggaaggcgcg
acccgctga

DBGET integrated database retrieval system