KEGG   Mycobacterium indicus pranii: MIP_03936Help
Entry
MIP_03936         CDS       T02325                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
mid  Mycobacterium indicus pranii
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:mid01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mid00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:mid00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2888987..2891140)
Genome map
AA seq 717 aa AA seqDB search
MLYDFVNEEALPGTDIDPDSFWAGVDKVVTDLTPKNQDLLRRRDELQAQIDKWHRQRVIE
PLDIDAYREFLTEIGYLLPEPADFTITTSGVDDEITTTAGPQLVVPVLNARFALNAANAR
WGSLYDALYGTDVISEDDGAEKGSSYNKVRGDKVIAYARKFLDEAVPLESGSWADATGLS
VEDGRLKVATADGSAGLADPDKFAGYTGELGSPSWSVLLVNHGLHIEILIDPDSPIGKTD
AAGIKDVILESAVTTIMDFEDSVAAVDADDKVLGYRNWLGLNKGDLSEDVDKDGKTFTRV
LNQDRTYSTPDGEGELTLPGRSLLFVRNVGHLMTNDAIVDAEGHEVFEGIMDALFTGLTA
IHGLKTSEANGPLANSRTGSIYIVKPKMHGPDEVAFTCELFSRVEDVLGLPQGTLKVGIM
DEERRTTVNLKACIKAAADRVVFINTGFLDRTGDEIHTSMEAGPMIRKGAMKSTTWIKAY
EDANVDIGLAAGFKGKAQIGKGMWAMTELMADMVEQKIGQPKAGATTAWVPSPTAATLHA
MHYHYVDVGAVQEELAGKKRTNIDELLTIPLAKELAWAPEEIREEVDNNCQSILGYVVRW
VAQGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRHGVITEEDVRASLERMAPLVDEQ
NAKDAAYLPMAPNFDDSLAFLAAQDLILTGTQQPNGYTEPILHRRRREAKARAAQSN
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
gtgctttacgacttcgtgaacgaagaggccttgcccggcaccgatatcgacccggacagc
ttctgggccggcgtggacaaggtcgtcaccgacctcaccccgaagaaccaggatctgctg
cgccggcgtgacgagctgcaggcccagatcgacaagtggcaccggcagcgggtcatcgag
ccgctcgacatcgacgcctaccgcgagttcctcaccgaaatcggttacctgctgcccgaa
cccgcggatttcacgatcaccacctcgggcgtcgacgacgagatcaccacgaccgcgggc
ccccagctcgtggtgccggtactcaacgcccggttcgcgctgaacgccgccaacgcccgg
tggggttcgctctacgacgccctgtacggcaccgacgtcatctcggaggacgacggcgcc
gaaaaggggtcgagctacaacaaggtgcgtggcgacaaggtcatcgcctacgcgcgcaaa
ttcctggacgaggccgtgccgctggagtccggctcgtgggccgacgcgaccggtctgtcc
gtcgaggacggccgcctgaaggtcgcgaccgccgacggctccgccggcctggccgacccg
gacaagttcgccggctacaccggcgagctcggctcccccagctggtcggtgctgctggtc
aaccacggcctgcacatcgagatcctcatcgatccggactcgccgatcggcaagaccgac
gccgccggcatcaaggacgtgatcctggaatcggccgtgaccacgatcatggacttcgag
gactcggtggccgccgtcgacgccgacgacaaggtgctcggctaccgcaactggctcggc
ctgaacaagggcgacctgtccgaggacgtcgacaaggacggcaagaccttcacccgggtg
ctcaaccaggaccgcacctactccacgcccgacggcgagggcgagctgaccctgccgggc
cgcagcctgctgttcgtccgcaacgtcggccacctgatgaccaacgacgcgattgtcgac
gcggagggtcacgaggtgttcgagggcatcatggacgcgctgttcaccgggctgaccgcg
attcacgggctcaagacgagtgaggcgaacgggccgctggccaacagccgcaccgggtcc
atctacatcgtcaagcccaagatgcacgggcccgacgaggtcgcgttcacctgcgagctg
ttcagccgggtcgaagacgtcctcgggctgccgcagggcaccctcaaggtcggcatcatg
gacgaggagcggcgcaccaccgtcaacctcaaggcctgcatcaaggccgcggccgaccgg
gtggtgttcatcaacaccggcttcctggaccgcaccggcgacgagatccacacctcgatg
gaggcgggtccgatgatccgcaagggcgcgatgaagagcaccacctggatcaaggcctac
gaggacgccaacgtcgacatcggcctggccgccgggttcaagggcaaggcgcagatcggc
aagggcatgtgggcgatgaccgaactgatggccgacatggtcgagcagaagatcggccag
cccaaggccggagcgaccaccgcgtgggtgccctcgccgacggcggccaccctgcacgcg
atgcactaccactacgtcgacgtgggcgccgtgcaggaggagctggcgggcaagaagcgc
accaacatcgacgagttgctgaccatcccgctggccaaggaactcgcctgggctcccgag
gagatccgcgaggaggtcgacaacaactgccagtccatcctcggctacgtggtgcgctgg
gtcgcccagggcgtgggatgctccaaggtgcccgacatccacgacgtggcgctcatggaa
gaccgtgcgacgctgcggatttcgagtcagctgctggcgaactggctgcgccacggtgtg
atcaccgaggaggacgtgcgcgccagcctcgagcggatggccccgctggtggacgagcaa
aacgccaaggatgcggcgtatttgccgatggcgcccaacttcgacgacagcctggcgttc
ctggcggcgcaggacctcatcctgaccggaacgcagcagcccaacggctacaccgagccg
atcctgcaccgccgtcggcgcgaggccaaggcgcgcgccgcgcagtcgaattga

DBGET integrated database retrieval system