KEGG   Mycobacterium indicus pranii: MIP_03973Help
Entry
MIP_03973         CDS       T02325                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mid  Mycobacterium indicus pranii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MIP_03973
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MIP_03973
  Lipid metabolism
   00071 Fatty acid degradation
    MIP_03973
  Amino acid metabolism
   00350 Tyrosine metabolism
    MIP_03973
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MIP_03973
   00626 Naphthalene degradation
    MIP_03973
Enzymes [BR:mid01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MIP_03973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2912357..2913385
Genome map
AA seq 342 aa AA seqDB search
MASPVTTTAMCAWRVRRPGPMDTGPLEQVTTEVPRPGPSELLVAVRACGVCRTDLHVTEG
DLPVHRERVTPGHEVVGEVVEIGPEAGDEFRVGDRVGIAWLRHTCGVCKYCRRGDENLCP
KSRYTGWDADGGYAEFATVPAAFAHPLPGGYSDSELAPLLCAGIIGYRSLLRADLPPGGR
LGLYGFGGSAHITAQVALAQGAEVHVMTRGARARELALELGAASAQGAADPPPAPLDAAI
LFAPVGDLVLPALQALDRGGTLAIAGIHLSDIPVLNYQRHLFQERQVRSVTSNTRADARA
FLDFAGEHHIEVTTPEYPLGQADRALTDLSAGRIAGAAVLLV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaccggtgaccaccacggcaatgtgcgcctggcgcgttcgtcgacccgggccg
atggataccggcccgctcgagcaggtcaccaccgaggtgccgcggccgggcccgtccgag
ctgctggtggccgtgcgcgcgtgcggggtgtgccggaccgacctgcacgtcaccgaaggc
gaccttcccgtccaccgcgagcgggtcacgcccgggcacgaggtggtgggggaggtcgtc
gaaatcggccccgaggccggcgacgagttccgggtgggggaccgggtgggcatcgcctgg
ctgcgccacacctgtggcgtgtgcaagtactgccgccgcggcgacgagaacctgtgcccg
aaatcccgctacaccggctgggacgccgacggcggctacgccgaattcgccaccgtcccg
gccgctttcgcgcaccccctgcccggcgggtacagcgacagcgaactcgccccgttgttg
tgcgcgggcatcatcggttaccgctcgctgcttcgcgccgacctgccgcccggcggacgg
ctgggcctctacggcttcggcggcagcgcgcacatcaccgcgcaggtcgccctggcgcag
ggagccgaggtgcacgtgatgacgcgcggagcccgggcccgcgagctggcgttggaactc
ggtgccgcatccgcacaaggcgcggcggatccgcccccggcgccactggacgccgcgatc
ctgttcgctcccgtcggtgatctggtgctgcccgcgctgcaggcgctggatcgcggtggc
acgctggcgatcgccgggatccacctctcggatatcccggtgctgaactaccagcgtcac
ctgtttcaggaacgccaggtccggtcggtcacctccaacacccgggccgacgcgcgggcc
ttcctcgatttcgcgggcgagcaccacatcgaggtgaccacgcccgaataccctctcgga
caagccgatcgggcgttgacggatctgagcgccgggcgcatcgcgggcgcagcggtgctg
ctggtgtga

DBGET integrated database retrieval system