KEGG   Mycobacterium indicus pranii: MIP_04209Help
Entry
MIP_04209         CDS       T02325                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mid  Mycobacterium indicus pranii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MIP_04209
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MIP_04209
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MIP_04209
Enzymes [BR:mid01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MIP_04209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3097373..3098326
Genome map
AA seq 317 aa AA seqDB search
MLKDEARNPTWSYKDRLAAVAVTKAAAFGASTVVVSSTGNHGAAVAAYAAAAGLGCVVLT
VSSVPREIRILMQAYGACVVAYDNGPDRWAVMRAAVEAFGWMPVSGLVTPQIGSNPFGIQ
GYKTIAFELWRQLGETPDVVVVPTAHGDGLAGLRRGFSDLVGLGLISRMPRLVAVDPFGA
YVGGLHREEGEQPTVATQPSMAFSVATRRATYQGLDAIRATNGTAIAEPSNDAIARMQLE
LASTEGIYAEGASVLAVLAAQQLAERRWIDPDESVVVLSTSTGLKDPGSSASHLPDLPVL
EPTLTALEGALPKGMCR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaagacgaagcgcgcaatccgacatggtcatacaaggacaggctcgcagcggtc
gccgtcacgaaggcggcggcctttggagcttcaaccgtcgtcgtctcctcgaccggcaac
cacggcgcagcggtcgccgcctacgccgccgccgcggggcttggctgcgtggtgctcacc
gtgtcgtcagtgccgcgcgagatcaggattctgatgcaggcctacggcgcctgcgtcgtc
gcttacgacaacggcccggaccggtgggcggtgatgcgggcggccgtcgaggcgttcggc
tggatgccggtatccgggcttgtgactccccagatcggctccaatccgtttggcattcag
gggtacaagacgatcgccttcgagctgtggcgccaactcggcgaaacgcccgacgttgtc
gtggtgccaaccgcccacggtgacgggttggccggtcttcgccggggattttccgacctc
gtcggtttgggtcttatcagccgcatgcctaggttggtcgcggtcgacccgttcggcgcc
tacgtcggcgggctccatcgcgaagaaggagagcagccaactgttgccactcagccgtca
atggcgttttccgtggcgacgcggagggccacctatcagggattggacgccataagagcc
accaacgggacggcgatcgccgaaccaagcaatgacgcgatcgcgcgcatgcaactcgaa
ttggcctcgaccgaaggcatttacgcagaaggggcgtccgtgttggcggtgctcgcagct
caacaacttgccgagcggaggtggatcgatcctgatgagagcgtggtggtgttgtcgacg
tcgaccgggttgaaggatcccggctcgtccgcgagccatttgccggatctaccggtgctt
gaacccaccctgacagctctcgaaggtgcgctgccgaaaggcatgtgccggtga

DBGET integrated database retrieval system