KEGG   Mycobacterium indicus pranii: MIP_04209Help
Entry
MIP_04209         CDS       T02325                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mid  Mycobacterium indicus pranii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MIP_04209
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MIP_04209
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MIP_04209
Enzymes [BR:mid01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MIP_04209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3097373..3098326
Genome map
AA seq 317 aa AA seqDB search
MLKDEARNPTWSYKDRLAAVAVTKAAAFGASTVVVSSTGNHGAAVAAYAAAAGLGCVVLT
VSSVPREIRILMQAYGACVVAYDNGPDRWAVMRAAVEAFGWMPVSGLVTPQIGSNPFGIQ
GYKTIAFELWRQLGETPDVVVVPTAHGDGLAGLRRGFSDLVGLGLISRMPRLVAVDPFGA
YVGGLHREEGEQPTVATQPSMAFSVATRRATYQGLDAIRATNGTAIAEPSNDAIARMQLE
LASTEGIYAEGASVLAVLAAQQLAERRWIDPDESVVVLSTSTGLKDPGSSASHLPDLPVL
EPTLTALEGALPKGMCR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaagacgaagcgcgcaatccgacatggtcatacaaggacaggctcgcagcggtc
gccgtcacgaaggcggcggcctttggagcttcaaccgtcgtcgtctcctcgaccggcaac
cacggcgcagcggtcgccgcctacgccgccgccgcggggcttggctgcgtggtgctcacc
gtgtcgtcagtgccgcgcgagatcaggattctgatgcaggcctacggcgcctgcgtcgtc
gcttacgacaacggcccggaccggtgggcggtgatgcgggcggccgtcgaggcgttcggc
tggatgccggtatccgggcttgtgactccccagatcggctccaatccgtttggcattcag
gggtacaagacgatcgccttcgagctgtggcgccaactcggcgaaacgcccgacgttgtc
gtggtgccaaccgcccacggtgacgggttggccggtcttcgccggggattttccgacctc
gtcggtttgggtcttatcagccgcatgcctaggttggtcgcggtcgacccgttcggcgcc
tacgtcggcgggctccatcgcgaagaaggagagcagccaactgttgccactcagccgtca
atggcgttttccgtggcgacgcggagggccacctatcagggattggacgccataagagcc
accaacgggacggcgatcgccgaaccaagcaatgacgcgatcgcgcgcatgcaactcgaa
ttggcctcgaccgaaggcatttacgcagaaggggcgtccgtgttggcggtgctcgcagct
caacaacttgccgagcggaggtggatcgatcctgatgagagcgtggtggtgttgtcgacg
tcgaccgggttgaaggatcccggctcgtccgcgagccatttgccggatctaccggtgctt
gaacccaccctgacagctctcgaaggtgcgctgccgaaaggcatgtgccggtga

DBGET integrated database retrieval system