KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_04282Help
Entry
MIP_04282         CDS       T02325                                 

Definition
(GenBank) Catechol O-methyl transferase
  KO
K00545  catechol O-methyltransferase [EC:2.1.1.6]
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
Pathway
mid00350  Tyrosine metabolism
mid01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    MIP_04282
Enzymes [BR:mid01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     MIP_04282
Exosome [BR:mid04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MIP_04282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_3 Methyltransf_24 Methyltransf_25 DUF531 GCD14 tRNA_U5-meth_tr
Motif
Other DBs
NCBI-ProteinID: AFS14926
UniProt: J9WI30
Position
3164693..3165442
Genome map
AA seq 249 aa AA seqDB search
MDLKRRIPLLRWSVWRMAVGNRNITTTGQIGDGREAAAVEYVLRNARAGDVDDVLTTIDK
FAYEKSMLINVGDEKGLLLDAAVRRADPALALELGTYCGYGALRIARAAPKAKVFSVELA
EANAANARQIWAHAGVADRVTCVVGTIGDGGRALDALAEHGFAAGAVDFVFLDHDKDAYL
DDLKSILDRGWLHPGSIVVADNVRVPGAPKYRGYMHRHQGTRWNTVEHKTHLEYQSLVSD
LVLESEYLG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggatctcaagcgacggatacccctgctgcggtggtcggtctggcggatggccgtcggg
aatcgcaacatcaccaccacgggccagatcggcgacgggcgcgaagccgccgccgtcgaa
tacgtgctgcgcaacgcccgggccggcgacgtcgacgacgtgctgacgaccatcgacaag
ttcgcctacgagaagtcgatgttgatcaatgtcggcgacgagaagggactgctgctcgac
gccgcggtgcggcgcgccgatccggcgctggcgctcgaattgggcacctactgcggctac
ggcgcgctgcgcatcgcccgggccgcgccgaaggccaaggtgttctcggtcgaactcgcc
gaggccaacgccgccaacgcccgccagatctgggcgcatgccggcgtggccgaccgtgtg
acgtgtgtggtcggcaccatcggcgacggcggccgcgccctggatgcgctggccgaacac
gggtttgccgctggcgcagtcgatttcgtgttcctcgatcacgacaaggacgcctatctc
gacgacctgaagagcatcctggatcggggctggctgcatcccggctcgatcgtggtcgcc
gacaatgtgcgggtgccgggcgcaccgaagtaccgcgggtacatgcaccggcatcagggc
acgcggtggaacaccgtcgagcacaagacccacctcgagtaccagtcgttggtgtccgac
ctggtgctggagtccgaatacctgggctga

DBGET integrated database retrieval system