KEGG   Mycobacterium indicus pranii: MIP_04282Help
Entry
MIP_04282         CDS       T02325                                 

Definition
Catechol O-methyl transferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
mid  Mycobacterium indicus pranii
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    MIP_04282
Enzymes [BR:mid01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     MIP_04282
Exosome [BR:mid04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MIP_04282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3164693..3165442
Genome map
AA seq 249 aa AA seqDB search
MDLKRRIPLLRWSVWRMAVGNRNITTTGQIGDGREAAAVEYVLRNARAGDVDDVLTTIDK
FAYEKSMLINVGDEKGLLLDAAVRRADPALALELGTYCGYGALRIARAAPKAKVFSVELA
EANAANARQIWAHAGVADRVTCVVGTIGDGGRALDALAEHGFAAGAVDFVFLDHDKDAYL
DDLKSILDRGWLHPGSIVVADNVRVPGAPKYRGYMHRHQGTRWNTVEHKTHLEYQSLVSD
LVLESEYLG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggatctcaagcgacggatacccctgctgcggtggtcggtctggcggatggccgtcggg
aatcgcaacatcaccaccacgggccagatcggcgacgggcgcgaagccgccgccgtcgaa
tacgtgctgcgcaacgcccgggccggcgacgtcgacgacgtgctgacgaccatcgacaag
ttcgcctacgagaagtcgatgttgatcaatgtcggcgacgagaagggactgctgctcgac
gccgcggtgcggcgcgccgatccggcgctggcgctcgaattgggcacctactgcggctac
ggcgcgctgcgcatcgcccgggccgcgccgaaggccaaggtgttctcggtcgaactcgcc
gaggccaacgccgccaacgcccgccagatctgggcgcatgccggcgtggccgaccgtgtg
acgtgtgtggtcggcaccatcggcgacggcggccgcgccctggatgcgctggccgaacac
gggtttgccgctggcgcagtcgatttcgtgttcctcgatcacgacaaggacgcctatctc
gacgacctgaagagcatcctggatcggggctggctgcatcccggctcgatcgtggtcgcc
gacaatgtgcgggtgccgggcgcaccgaagtaccgcgggtacatgcaccggcatcagggc
acgcggtggaacaccgtcgagcacaagacccacctcgagtaccagtcgttggtgtccgac
ctggtgctggagtccgaatacctgggctga

DBGET integrated database retrieval system