KEGG   Mycobacterium indicus pranii: MIP_04456Help
Entry
MIP_04456         CDS       T02325                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mid  Mycobacterium indicus pranii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MIP_04456
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MIP_04456
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MIP_04456
Enzymes [BR:mid01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MIP_04456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3298024..3298839)
Genome map
AA seq 271 aa AA seqDB search
MTVKQSEASRLGPIFDVCRDDGRAALIGYLPTGYPDVTTSVHAMVALVESGCDIVEVGVP
YSDPGMDGPTIAKATEAALHGGVRVRDTLAAVEAISAAGGHAVVMTYWNPVLRYGIDAFA
RDLASAGGYGLITPDLIPDEAGQWLAASEEHRLDRIFLVAPSSTPQRLAMTVEASRGFVY
AASTMGVTGARDVVSNAAPELVGRVKEISNIPVGVGLGVRSGEQAAQIGGYADGVIVGSA
LVSALGDGGLNALRALTEELAAGVRQRAAAS
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcaagcagagcgaggccagcaggctcgggcccatcttcgacgtgtgccgcgac
gacggtcgcgccgcgctgatcggctatctgcccaccgggtacccggatgtgacgacgtcc
gtgcacgcgatggtcgccctggtcgaatccggttgcgacatcgtcgaagtcggggtgccc
tattcggatcccggcatggacggcccgaccatcgccaaggccaccgaggccgcgctgcac
gggggagtgcgcgtccgcgacaccctggccgcggtcgaggcgatcagcgccgccggtggc
cacgccgtggtgatgacctactggaaccccgtgttgcgctacggaattgacgccttcgcc
cgcgacctggcatcggccggcggatacggcctgatcactccggacctcatccccgacgaa
gccgggcagtggttggcggcgtccgaggagcatcggttggaccggatatttctggtggcg
ccctcctcgacgccgcagcgcttggcgatgacggtcgaggcgtcccgcggattcgtctac
gcggcgtcgacgatgggcgtcacgggagcacgcgacgtggtgtccaatgccgcgcccgaa
ttggtgggcagggtcaaggagatatcgaacatccccgtcggtgtcgggctgggggtgcgg
tcgggtgagcaagccgcccagatcggcggctacgccgacggtgtcattgtcggttccgcg
ctggtgtcggcgctgggggacgggggtttgaacgcattgcgcgcactcactgaggaactc
gccgccggtgtacgtcaaagggcggccgcgtcgtga

DBGET integrated database retrieval system