KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_04457Help
Entry
MIP_04457         CDS       T02325                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
Pathway
mid00260  Glycine, serine and threonine metabolism
mid00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mid01100  Metabolic pathways
mid01110  Biosynthesis of secondary metabolites
mid01130  Biosynthesis of antibiotics
mid01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MIP_04457
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MIP_04457
Enzymes [BR:mid01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MIP_04457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Gmad2
Motif
Other DBs
NCBI-ProteinID: AFS15032
UniProt: J9WKJ2
Position
complement(3298836..3300098)
Genome map
AA seq 420 aa AA seqDB search
MMVDLSRPDLPLPSAAIAEPTRHEPDAGGHFGVYGGRYVAEALMAVIEEVTAAYEKERVN
QDFLDTLDYLQAHYAGRPSPLYEAPRLSEQAGARIFLKREDLNHTGSHKINNVLGQALLA
QRMGKKRVIAETGAGQHGVATATACALLGLECVIYMGAVDTERQALNVARMRLLGATVVS
VQSGSRTLKDAINEAFRDWVTNADNTFYCFGTAAGPHPFPAMVRDFQRIIGLEARAQIQA
QAGRLPDAVLACIGGGSNAIGIFHPFIDDPGVRLIGFEAAGDGVETGRHAATFSGGSPGA
FQGSFSYLLQDEDGQTIESHSISAGLDYPGVGPEHAWLRESGRAEYRPITDSEAMEAFRT
LCRTEGIIPAIESAHAVAGALKVAPELGTAAIIVVNLSGRGDKDVETAAQWFGLLGSSDR
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtgatggtggatctgtcccgcccggaccttccgcttccgagcgcagccatcgccgaaccc
acccgccacgaacccgatgcgggtggccatttcggcgtgtacggcggccgctacgtcgcc
gaggcgttgatggccgtgatcgaagaggtcaccgcggcctacgagaaggagcgcgtcaac
caggatttcctggacaccctggactatctgcaggcgcactacgccgggcggccgtcaccg
ctgtatgaggcgcctcggctgtccgagcaggccggcgcccgcatcttcctcaagcgagaa
gacctgaaccacaccggttctcacaagatcaacaacgtgctcggccaggcgctgctcgct
cagcggatgggcaagaagcgggtgatcgccgagaccggggccggtcagcacggcgtggcg
accgccaccgcgtgcgccctgctcggcctggaatgtgtgatctacatgggcgccgtcgac
accgaacgccaggcgctcaacgtggcccggatgcgcttgctgggagccacggtcgtctcg
gtccagagcggttcgaggacgctcaaggacgccatcaatgaagcgttccgggattgggtt
accaatgccgacaacaccttctactgcttcggcacggcggcggggccccatccctttccc
gccatggtgcgcgactttcagcgcatcatcggcctcgaggcgcgcgcccagatccaggcg
caggcgggccggctgcccgacgcggtgctggcctgcatcggtggcggatcgaacgccatc
ggcatcttccacccgttcatcgacgatcccggcgtgcggctgatcggcttcgaggcggcc
ggcgacggcgtcgaaaccggaaggcacgccgcgaccttcagcggcggttcccccggggcg
ttccagggatcgttctcctacctgctgcaggacgaggacgggcagaccatcgaatcccat
tccatctcagcgggtctcgactacccgggggtgggtccggaacacgcgtggctgcgcgag
agcggacgcgccgaataccggccgatcaccgactccgaagcgatggaggcattccgcacc
ctgtgccgcaccgaggggatcatccccgccatcgaatccgcgcacgcggtggccggggcc
ctgaaggtggcccccgaattggggacggccgcgatcatcgtggtgaacctgtccggccgt
ggggacaaggacgtcgagacggccgcgcagtggttcgggctgttgggatccagcgaccga
tga

DBGET integrated database retrieval system