KEGG   Mycobacterium indicus pranii: MIP_04457Help
Entry
MIP_04457         CDS       T02325                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mid  Mycobacterium indicus pranii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mid01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mid00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mid00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3298836..3300098)
Genome map
AA seq 420 aa AA seqDB search
MMVDLSRPDLPLPSAAIAEPTRHEPDAGGHFGVYGGRYVAEALMAVIEEVTAAYEKERVN
QDFLDTLDYLQAHYAGRPSPLYEAPRLSEQAGARIFLKREDLNHTGSHKINNVLGQALLA
QRMGKKRVIAETGAGQHGVATATACALLGLECVIYMGAVDTERQALNVARMRLLGATVVS
VQSGSRTLKDAINEAFRDWVTNADNTFYCFGTAAGPHPFPAMVRDFQRIIGLEARAQIQA
QAGRLPDAVLACIGGGSNAIGIFHPFIDDPGVRLIGFEAAGDGVETGRHAATFSGGSPGA
FQGSFSYLLQDEDGQTIESHSISAGLDYPGVGPEHAWLRESGRAEYRPITDSEAMEAFRT
LCRTEGIIPAIESAHAVAGALKVAPELGTAAIIVVNLSGRGDKDVETAAQWFGLLGSSDR
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtgatggtggatctgtcccgcccggaccttccgcttccgagcgcagccatcgccgaaccc
acccgccacgaacccgatgcgggtggccatttcggcgtgtacggcggccgctacgtcgcc
gaggcgttgatggccgtgatcgaagaggtcaccgcggcctacgagaaggagcgcgtcaac
caggatttcctggacaccctggactatctgcaggcgcactacgccgggcggccgtcaccg
ctgtatgaggcgcctcggctgtccgagcaggccggcgcccgcatcttcctcaagcgagaa
gacctgaaccacaccggttctcacaagatcaacaacgtgctcggccaggcgctgctcgct
cagcggatgggcaagaagcgggtgatcgccgagaccggggccggtcagcacggcgtggcg
accgccaccgcgtgcgccctgctcggcctggaatgtgtgatctacatgggcgccgtcgac
accgaacgccaggcgctcaacgtggcccggatgcgcttgctgggagccacggtcgtctcg
gtccagagcggttcgaggacgctcaaggacgccatcaatgaagcgttccgggattgggtt
accaatgccgacaacaccttctactgcttcggcacggcggcggggccccatccctttccc
gccatggtgcgcgactttcagcgcatcatcggcctcgaggcgcgcgcccagatccaggcg
caggcgggccggctgcccgacgcggtgctggcctgcatcggtggcggatcgaacgccatc
ggcatcttccacccgttcatcgacgatcccggcgtgcggctgatcggcttcgaggcggcc
ggcgacggcgtcgaaaccggaaggcacgccgcgaccttcagcggcggttcccccggggcg
ttccagggatcgttctcctacctgctgcaggacgaggacgggcagaccatcgaatcccat
tccatctcagcgggtctcgactacccgggggtgggtccggaacacgcgtggctgcgcgag
agcggacgcgccgaataccggccgatcaccgactccgaagcgatggaggcattccgcacc
ctgtgccgcaccgaggggatcatccccgccatcgaatccgcgcacgcggtggccggggcc
ctgaaggtggcccccgaattggggacggccgcgatcatcgtggtgaacctgtccggccgt
ggggacaaggacgtcgagacggccgcgcagtggttcgggctgttgggatccagcgaccga
tga

DBGET integrated database retrieval system