KEGG   Mycobacterium indicus pranii: MIP_04458Help
Entry
MIP_04458         CDS       T02325                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mid  Mycobacterium indicus pranii
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MIP_04458
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MIP_04458
Enzymes [BR:mid01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     MIP_04458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3300169..3300972)
Genome map
AA seq 267 aa AA seqDB search
MLDSILEGVRADVAAREALISLSEIKAAAAAAPPPRDVMAALREPGIGVIAEVKRASPSA
GSLATIADPAKLARAYEDGGARIISVLTEERRFHGSLDDLDAVRAAVSIPILRKDFVVQP
YQIHEARAHGADMLLLIVAALEQSALVSMLDRTESLGMTALVEVHTEEEADRALKAGANV
IGVNARDLATLAVDRDCFARIAPGLPSNVIRIAESGVRGTADLLAYAGAGADAVLVGEGL
VKSGDPRAAVADLVTAGTHPSCPKPSR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgcttgactccatcctcgagggagtccgggccgacgttgccgcgcgcgaagccctcatc
agcctgtccgagatcaaggccgccgcggcggccgcgccgccgccccgcgacgtgatggcc
gccctgcgcgagcccggaatcggcgtcatcgccgaagtcaagcgcgccagcccgtcggcg
ggttccctggcgaccattgccgatccggccaaattggccagggcgtacgaggacggcggc
gcgcgcatcatcagcgtcttgaccgaggagcgccgctttcacggttcgctcgacgatctc
gacgcggttcgggcggcggtctcgataccgattttgcgcaaagactttgtggtgcagccc
tatcagatccacgaagcgcgtgcgcacggcgccgacatgttgttgctcatcgtcgccgcg
ctggagcagtcggcgttggtgtcgatgctggaccgcaccgaatcgctgggcatgacggca
ctcgtcgaggtgcacaccgaagaggaagccgaccgcgcgctcaaggccggggccaacgta
atcggcgtcaacgcccgcgatctggccacgctggcggtggaccgggattgcttcgcgcgc
atcgctcccgggctgcccagcaacgtgatcaggatcgccgaatccggtgtgcgcggtacc
gcagacctgctggcgtacgccggtgcgggtgccgacgccgtgttggtgggcgaaggtctg
gtcaaaagtggtgacccgcgcgccgcggtcgccgatctggtcaccgcgggcacccatccg
tcctgtccgaaaccctctcgctag

DBGET integrated database retrieval system