KEGG   Mycobacterium indicus pranii: MIP_04791Help
Entry
MIP_04791         CDS       T02325                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mid  Mycobacterium indicus pranii
Pathway
mid00010  Glycolysis / Gluconeogenesis
mid00051  Fructose and mannose metabolism
mid00562  Inositol phosphate metabolism
mid01100  Metabolic pathways
mid01110  Biosynthesis of secondary metabolites
mid01120  Microbial metabolism in diverse environments
mid01130  Biosynthesis of antibiotics
mid01200  Carbon metabolism
mid01230  Biosynthesis of amino acids
Module
mid_M00002  Glycolysis, core module involving three-carbon compounds
mid_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MIP_04791
   00051 Fructose and mannose metabolism
    MIP_04791
   00562 Inositol phosphate metabolism
    MIP_04791
Enzymes [BR:mid01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MIP_04791
Exosome [BR:mid04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MIP_04791
  Exosomal proteins of bladder cancer cells
   MIP_04791
  Exosomal proteins of melanoma cells
   MIP_04791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFS15239
UniProt: J9WDB3
Position
complement(3575503..3576288)
Genome map
AA seq 261 aa AA seqDB search
MSRKPLIAGNWKMNLNHFEAIALVQKIAFALPDKYYDKVDVTVLPPFTDLRSVQTLVDGD
KLRLTYGGQDLSQHDAGAYTGEISGAFLAKLGCTFVVVGHSERRTYHHEDDTVVAAKTAA
ALKHELTPIVCIGEHLEVREAGNHVIHCEEQLRGALAGLSTEQIGKVVIAYEPVWAIGTG
RVASAADAQEVCAAIRKELASLASPQVADSVRVLYGGSVNAKNVGELVAQDDIDGGLVGG
ASLDGEQFATLAAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcaagccactgatcgccggcaactggaagatgaacctcaaccacttcgaggcg
atcgcgctggtgcaaaagatcgcgttcgcgctgccggacaagtactacgacaaggtcgac
gtcacggtgctgccgccgttcaccgacctgcgcagcgtgcagaccctggtcgacggcgac
aagctgcggctgacctacggcgggcaggacctgtcccagcacgacgccggggcctacacc
ggcgagatcagcggcgccttcctggccaagctgggctgcacgttcgtcgtcgtcgggcac
tccgagcgcaggacgtaccaccacgaggacgacaccgtcgtcgccgccaagaccgccgcg
gcgctcaagcacgaactgaccccgatcgtctgcatcggcgagcacctcgaggtgcgcgag
gccggaaaccacgtcatccactgcgaagagcagctgcggggggcgctggccgggctgtcc
accgaacagatcggcaaggtcgtcatcgcctacgagccggtgtgggcgatcggcaccggg
cgggtggccagcgccgccgacgcccaggaggtgtgcgcggcgatccgcaaggagttggcg
tcgctcgcctcgccccaggtcgccgactcggtgcgggtgctctacggcggctcggtcaac
gccaagaacgtcggcgagctcgtcgcccaggacgacatcgacggcggcctggtcggcggc
gcgtcgctggacggcgagcaattcgccacgctggcggccatcgccgccggtgggcctctt
ccgtga

DBGET integrated database retrieval system