KEGG   Mycobacterium indicus pranii: MIP_04860Help
Entry
MIP_04860         CDS       T02325                                 

Definition
Aspartate carbamoyl transferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mid  Mycobacterium indicus pranii
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MIP_04860
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MIP_04860
Enzymes [BR:mid01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     MIP_04860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3628382..3629341)
Genome map
AA seq 319 aa AA seqDB search
MTRHLLAAGDLSLDDATAILDDADRFAQALVGREIKKLPTLRGRTIVTMFYENSTRTRVS
FEVAGKWMSADVINVSAAGSSVGKGESLRDTALTLRAAGADALIIRHPASGAAHLLAEWT
RAGGDSGPSVINAGDGTHEHPTQALLDALTIRQRLGGIEGRRVVIVGDVLHSRVARSNVM
LLHTLGAEVVLVAPPTLLPVGVDGWPVTVSNDFDAELPAADAVLMLRVQAERMNGGFFPS
VREYSSLYGLSDRRQAMLPGHAVVLHPGPMLRGMEIASSVADSSQSAVLQQVSNGVHVRM
AVLFHVLVGAESAGSEGAA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgacccgacacctgcttgccgccggggacctgagcctcgacgacgccaccgccatcctc
gacgacgccgaccgcttcgcccaggcgctggtcggccgcgagatcaagaaactgccgacg
ctgcgcggccgcaccatcgtgacgatgttctacgagaactcgacccgcacccgggtgtcc
ttcgaggtggccggcaagtggatgagcgccgacgtgatcaacgtcagcgccgccggatcg
tcggtgggcaagggcgagtcgctgcgcgacaccgcgctgacgctgcgggccgccggggcc
gatgcgctgatcatccggcacccggcgtcgggggccgcgcacctgcttgccgaatggaca
cgcgccggcggcgattccggcccctcggtgatcaacgccggcgacggcacccatgagcac
ccgacgcaggcgctgctggacgcgctcaccatccgccagcggctcggcggcatcgagggc
cggcgggtcgtgatcgtcggcgacgtcctgcacagccgggtcgcccgctccaacgtcatg
ctgctgcacaccctgggcgccgaagtggtgctggtggcaccgccgacgctgctgccggtc
ggcgtcgacggctggccggtgacggtgtcgaacgacttcgacgccgagctgcccgccgcc
gacgcggtgctgatgctgcgcgtgcaggccgagcggatgaacggcggcttcttcccgtcg
gtgcgcgaatactcgtccctgtacgggctttccgatcgccgccaggcgatgctgcccggg
cacgccgtggtgctgcaccccgggccgatgctgcgcggcatggagatcgcgtcatcggtg
gccgattcgtcgcaatcggccgtgctgcaacaggtttccaatggtgtgcacgtgcggatg
gcggtgctgttccacgtgctggtgggtgccgagtcggctggaagcgaaggggccgcatga

DBGET integrated database retrieval system