KEGG   Mycobacterium indicus pranii: MIP_04860Help
Entry
MIP_04860         CDS       T02325                                 

Definition
Aspartate carbamoyl transferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mid  Mycobacterium indicus pranii
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mid00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mid00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3628382..3629341)
Genome map
AA seq 319 aa AA seqDB search
MTRHLLAAGDLSLDDATAILDDADRFAQALVGREIKKLPTLRGRTIVTMFYENSTRTRVS
FEVAGKWMSADVINVSAAGSSVGKGESLRDTALTLRAAGADALIIRHPASGAAHLLAEWT
RAGGDSGPSVINAGDGTHEHPTQALLDALTIRQRLGGIEGRRVVIVGDVLHSRVARSNVM
LLHTLGAEVVLVAPPTLLPVGVDGWPVTVSNDFDAELPAADAVLMLRVQAERMNGGFFPS
VREYSSLYGLSDRRQAMLPGHAVVLHPGPMLRGMEIASSVADSSQSAVLQQVSNGVHVRM
AVLFHVLVGAESAGSEGAA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgacccgacacctgcttgccgccggggacctgagcctcgacgacgccaccgccatcctc
gacgacgccgaccgcttcgcccaggcgctggtcggccgcgagatcaagaaactgccgacg
ctgcgcggccgcaccatcgtgacgatgttctacgagaactcgacccgcacccgggtgtcc
ttcgaggtggccggcaagtggatgagcgccgacgtgatcaacgtcagcgccgccggatcg
tcggtgggcaagggcgagtcgctgcgcgacaccgcgctgacgctgcgggccgccggggcc
gatgcgctgatcatccggcacccggcgtcgggggccgcgcacctgcttgccgaatggaca
cgcgccggcggcgattccggcccctcggtgatcaacgccggcgacggcacccatgagcac
ccgacgcaggcgctgctggacgcgctcaccatccgccagcggctcggcggcatcgagggc
cggcgggtcgtgatcgtcggcgacgtcctgcacagccgggtcgcccgctccaacgtcatg
ctgctgcacaccctgggcgccgaagtggtgctggtggcaccgccgacgctgctgccggtc
ggcgtcgacggctggccggtgacggtgtcgaacgacttcgacgccgagctgcccgccgcc
gacgcggtgctgatgctgcgcgtgcaggccgagcggatgaacggcggcttcttcccgtcg
gtgcgcgaatactcgtccctgtacgggctttccgatcgccgccaggcgatgctgcccggg
cacgccgtggtgctgcaccccgggccgatgctgcgcggcatggagatcgcgtcatcggtg
gccgattcgtcgcaatcggccgtgctgcaacaggtttccaatggtgtgcacgtgcggatg
gcggtgctgttccacgtgctggtgggtgccgagtcggctggaagcgaaggggccgcatga

DBGET integrated database retrieval system