KEGG   Mycobacterium indicus pranii: MIP_04933Help
Entry
MIP_04933         CDS       T02325                                 

Definition
Class II aldolase/adducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mid  Mycobacterium indicus pranii
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mid00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3673306..3674103)
Genome map
AA seq 265 aa AA seqDB search
MASTFTDSKSDLMRRAAEQLTALQSKDAADAPLTTRQKLALTCRALFDAGHDSGLAGQIT
ARAERDGTYYTQRLGLGFDEITDANLLLVDEDLNVLEGDGIANPANRFHSWIYRARPDVQ
CIVHTHAFHVAALSMLEVPLIVSHMDTTPLYGDCAFLEKWPGVPVGNEEGEIISAALGDK
KAVLLAHHGHVIAGASVEEACSLGILIERAAKLQLAAMAAGTVKELPEELAREAHDWTLS
PQRSRANFAYYARRALARHPDALTS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggccagcacgttcaccgattcgaaatccgacttgatgcgccgcgcggccgagcagttg
acggcccttcaatccaaggacgccgccgatgcgccgctgaccacccgccagaagctcgcc
ctgacgtgccgcgccctgttcgacgccgggcacgattccgggttggccgggcagatcacc
gcccgcgccgagcgggacggcacctactacacccagcggctcggtctgggcttcgacgag
atcaccgacgccaacctgcttttggtcgacgaggacctcaacgtccttgagggagacgga
atcgccaaccccgccaaccgctttcacagctggatctatcgcgcccgccccgatgtgcaa
tgcatcgtgcacacgcacgcgttccacgtggccgcgctgtcgatgctggaagttccgctg
atcgtgtcccacatggacaccacgccgctctacggcgactgcgcgttcctggagaaatgg
cccggcgtgccggtcggcaacgaggagggggagatcatctccgccgcgctgggggacaag
aaggcggtcctgctggcccaccacggccacgtcatcgccggcgccagcgtcgaggaggcg
tgctcgttgggcatcctcatcgagcgcgccgcgaaactgcagctggccgcgatggccgcc
ggcaccgtcaaagagctacccgaggagctggcccgcgaggcccacgactggacactgtcg
ccgcagcgcagccgcgccaacttcgcctactacgcccgccgggccctggcccggcacccg
gacgcgctgaccagctaa

DBGET integrated database retrieval system