KEGG   Mycobacterium indicus pranii: MIP_04982Help
Entry
MIP_04982         CDS       T02325                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mid  Mycobacterium indicus pranii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mid00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MIP_04982
Enzymes [BR:mid01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MIP_04982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3700399..3700998)
Genome map
AA seq 199 aa AA seqDB search
MIAAVRGEVLEVALDHAVIEAAGVGYRVNATPSTLSTLRTGTEARLITAMIVREDSMTLY
GFTDTDTRDLFLTLLSVSGVGPRLAMATLAVHDAGALRQALHDGDVAALTRVPGIGKRSA
ERMVLELRDKVGAAGAGAAAAGAALNGHAIRGPVVEALVGLGFAVKQAEEATDKVLAAEQ
DATTSGALRAALSLLGKSR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcggtgcgcggcgaggtgctcgaggtggcgctcgaccatgcggtgatcgag
gccgccggcgtcggctaccgggtgaacgcgacgccgtcgacgctgtccacgctgcggacc
gggaccgaggcgcggctgatcaccgcgatgatcgtccgcgaggattcgatgacgctgtac
ggtttcaccgacaccgacacccgcgacctgtttttgaccctgctgtcggtgtcgggggtc
gggccccggctggcgatggcgaccctggccgtgcacgacgccggcgcgctgcgccaggcg
ctgcacgacggcgacgtcgccgcgctgacccgggtccccgggatcggcaaacgcagtgcc
gaacggatggtcctggagctgcgggacaaggtgggcgccgccggtgcgggcgcggccgcc
gcgggcgccgcgctcaacggccacgcgatccgcgggccggtggtggaggccctggtgggc
ctcgggttcgccgtcaagcaggccgaggaagccaccgacaaggtgctggccgccgagcag
gacgcgaccacctccggtgcgctgcgcgccgccctgtcgctgctgggcaagtcccgatga

DBGET integrated database retrieval system