KEGG   Mycobacterium indicus pranii: MIP_05125Help
Entry
MIP_05125         CDS       T02325                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mid  Mycobacterium indicus pranii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MIP_05125
Enzymes [BR:mid01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     MIP_05125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3781408..3782715)
Genome map
AA seq 435 aa AA seqDB search
MSLGDDAAITLFDPGERLGGILRTELVGGAPMDLGAEAFVLRRPELPALLDELNLTGHQL
VSTGARPLIYSGQRLRPLPTGTIVGIPSSAASVAGLVDEATVARIDAEPSRPLEWVAGSD
PAVADLVGDRFGDQVVARSVDPLLSGVYAGSAATIGLRAAAPTVAAALDRGAASLTDAVG
RVVPPATGAPVFGALDGGYRVLVEELAARARPRWVRAAASRLERADAGWAVFDDTGARWG
ADAVILAVPVHESCRLLGGIAPRSVAAAGRIASASSVVLALAVPADTAFPDCSGVLVATG
ERLRAKAITLSSRKWGARADVQLLRLSFGRFGDHVAASTSDDELLAWALGDVAAVFGLDI
DPVDVRVQRWIDAMPQYGPGHADLVAEVRAGLPPTLAVAGSYLDGIGVPACVGAAGRAAE
DVIRAIGGPDAQVAR
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtccctcggcgacgacgcggccatcacgctgttcgacccgggggagcggctcggcggg
atcctgcgcacggagctggtcggcggggcgccgatggatctgggcgccgaggcgttcgtg
ctgcgccgacccgagctgccggcgctgctggacgagctgaatctgactgggcaccaactg
gtttcgaccggtgctcgcccgctgatctacagcgggcaacggctgcgcccgctccccacc
ggcacgatcgtgggcatcccgtcgtcggcggcgtcggtggccggattggtcgacgaggcg
accgtcgcccgcatcgacgccgaaccctcccgcccgttggagtgggtcgccggcagcgat
cccgcggtggccgacctggtgggcgaccggttcggcgaccaggtggtcgcgcggtcggtg
gacccgctgctgagcggggtctacgcgggctcggcggccaccatcggcctgcgtgcggcc
gccccgaccgtggccgcggcgctggaccgtggcgccgccagcctgaccgacgccgtcggg
cgggtcgtgccgccggccaccggcgcgccggtgttcggcgcgctcgacggcgggtaccgg
gtgctggtcgaggagctcgccgcgcgcgcccggccgcgctgggtgcgcgccgccgcgtcg
cggctcgagcgcgccgacgcgggctgggcggtgttcgacgacaccggcgcccgctggggc
gccgacgcggtgatcctggccgtgcccgtgcacgaatcgtgccgcctgctcggcggcatc
gcgccccgcagcgtcgccgcggccgggcgcatcgcgagcgcatcgtcggtggtgctggcg
ctggccgtgccggctgacaccgcgttccccgactgctcgggcgtgctggtggccaccggg
gagcggttgcgggccaaggccatcacgctgtcgtcccgcaagtggggcgcccgggccgac
gtgcagctgttgcggttgtcgttcgggcggttcggcgaccacgtggcggccagcacctcc
gacgacgagctgctggcctgggcgctgggggatgtggccgccgtgttcgggctcgacatc
gaccccgtcgacgtccgggtgcagcgctggatcgacgccatgccgcagtacggccccggc
catgccgacctggtcgccgaggtgcgcgccggactgccgccgacgctcgcggtggcgggg
agctacctcgacggcatcggcgtgcccgcctgcgtcggcgcggccgggcgtgcggccgag
gatgtgatcagggccatcggaggtccggacgcgcaagtggcacgatag

DBGET integrated database retrieval system