KEGG   Mycobacterium indicus pranii: MIP_05317Help
Entry
MIP_05317         CDS       T02325                                 

Definition
chelatase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mid  Mycobacterium indicus pranii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mid00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3907447..3909288)
Genome map
AA seq 613 aa AA seqDB search
MRPYPFSAIVGHDQLRLALLLCAVRPEIGGALIRGEKGTAKSTAVRGLAALLSAATGSDS
GLVEMPLGATEDRVIGSLDLQRVLRDGEHAFSPGLLARAHGGVLYVDEVNLLHDHLVDVL
LDAAAMGRVHIERDGISHSHEARFVLIGTMNPEEGELRPQLLDRFGLTVDVHASRDVDVR
VQVIRQRMAYEADPDGFAERYADADAELARRIAAARALVDEVGLPDTELRRIAALCAAFD
VDGMRADLVVARTAVAHAAWRGADTVSEQDIRVAAELALPHRRRRDPFDDPGIDRDQLDE
ALAQAGSDPDPEPDPPGGGQTADTEQEGPQRDSGESAPAPPPKTKPSAPPSKTFRTRALR
VPGVGEGAPGRRSRARNASGSVIAATDGDDASCGGHGLHLFATLLAAAERAGAGPLRPEP
DDVRRAVREGREGNLVIFVVDASGSMAARDRMAAVSGATLSLLRDAYQRRDKVAVITFRH
QEARLLLPPTSSAHIAGRRLSRFDTGGKTPLAEGLLAARELIVREKARDRARRCLVVVLT
DGRATAGPDPLGRTRSAAARLVAEGAAAVVVDCETSFVRLGLAEQLARQLGAPAVRLEQL
HADSLTRAVRDVA
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
gtgaggccgtatccgttcagcgccatcgtcgggcacgaccagctgcggcttgccctgctg
ttgtgcgccgtgcgccccgagatcggcggcgcgctcatccgcggcgaaaagggcaccgcc
aagtcgacagccgtgcgcggcctggcggcgttgctgtccgctgcgaccggcagcgattcc
ggcctggtcgaaatgccgctcggggcaaccgaagacagggtgatcggctccctggatctg
cagcgcgtgctgcgcgacggcgagcacgcgttttcgccgggtctgctggcccgcgcgcac
ggcggcgtgctctatgtcgacgaggtcaacctgctgcacgatcatctcgtcgacgtgctg
ctcgacgcggcggcgatggggcgcgtgcacatcgaacgcgacggcatctcgcattcgcac
gaagcgcggttcgtgttgatcggcaccatgaatcccgaagagggcgaactgcgtccgcag
ctgttggaccggttcgggctcaccgttgacgtgcacgcctcacgcgacgtcgacgtgcgg
gtgcaggtcatccggcagcggatggcctatgaggccgacccggacggtttcgccgagcgc
tatgccgatgccgacgccgagctggcccggcgcatcgccgcggcccgtgcgctcgtcgac
gaggtggggttgcccgacaccgagttacggcgcatcgccgcgctgtgcgcggcgttcgac
gtcgacggcatgcgcgcggacctcgtggtggcccgcaccgccgtcgcgcacgccgcctgg
cgcggcgcggacaccgtctcagaacaagacatccgggtggccgccgagctggcgctgccg
catcggcgccgccgcgatcccttcgacgatccgggtatcgaccgcgaccagctggacgag
gcactggcgcaggccggctcagacccggaccccgagcccgacccgcccggtgggggtcaa
acggccgacaccgaacaggaagggccgcaacgggattcgggggagagcgccccggcaccg
ccgccgaagaccaagcccagcgccccgccgtcgaaaaccttccgcacccgcgcgctgcgg
gttcccggcgtcggggagggagcacccggccgacggtcacgggcgcgcaacgccagcggc
agcgtcatcgccgccaccgacggggacgacgccagttgcggcgggcacggtctgcacctg
ttcgccacgctgctcgcggccgccgaacgcgccggagccgggccgttgcggcccgagccc
gacgatgtgcgccgcgccgtgcgcgagggacgcgaaggcaacctggtgatcttcgtcgtc
gacgcctcgggttcgatggccgcccgggaccgcatggcggcggtcagcggcgccacactc
tcgttgctgcgcgacgcctatcagcgccgcgacaaggtcgccgtgatcaccttccggcac
caggaggcgcggttgttgttgccgccgacctcgtcggcccacatcgccggccggcgactg
tcccggttcgacaccggcggcaagaccccgctggccgaaggcctgctggccgcgcgtgag
ctgatcgtccgggagaaggcgcgtgaccgggcccgccgctgcctggtggtggtgctcacc
gacggccgcgccaccgccggcccggatccgttgggccgcacccgatccgcggcggcccgg
ttggtcgccgaaggcgccgccgcggtggtcgtggactgcgaaacgtctttcgtgcggctg
ggcttggccgagcagctggcccgccagctcggtgcaccggccgttcggctagagcagttg
cacgccgattcgttgacgcgtgcggtacgcgacgtggcgtga

DBGET integrated database retrieval system