KEGG   Mycobacterium indicus pranii: MIP_05379Help
Entry
MIP_05379         CDS       T02325                                 

Definition
1-deoxy-D-xylulose 5-phosphate reducto isomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mid  Mycobacterium indicus pranii
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MIP_05379
Enzymes [BR:mid01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     MIP_05379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3947709..3948920)
Genome map
AA seq 403 aa AA seqDB search
MTNPTTDGQTPGRVRVLVLGSTGSIGTQALDVIAANPDRFEVVGLAAGGANLDTLLHQRA
ATGVTNIAVADEAAARRAGDIPFAGPEAVTRLVQETEADVVLNALVGALGLRPTLAALES
GARLALANKESLIAGGPLVLKAAKPGQIVPVDSEHSALAQCLRGGTPDEVAKLVLTASGG
PFRGWTAAQLEDVTPEQAGAHPTWSMGPMNTLNSASLVNKGLELIETHLLFGLPYDRIEV
VVHPQSIVHSMVTFVDGSTLAQASPPDMRLPIALALGWPRRVPGAAASCDFSTASSWEFE
PLDNGVFPAVELARHAGQTGGCMTAVYNAANEEAAQAFLAGRIGFGAIVKTIADVLHAAD
QWAVSPANVDEVLDAQRWARERAQRVVAQAQPANLSVKASGAV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaacccgacgaccgacgggcaaaccccgggccgcgtgcgcgtgctggtgctgggc
agcaccggctccatcggcacccaggcgctggacgtcatcgcggccaatccggaccgcttc
gaagtggtcggcctggccgcgggtggggcgaacctggacacgctgctgcaccagcgcgcc
gccaccggtgtgaccaacatcgcggtcgccgacgaagcggcggcgcggcgggccggcgac
atcccctttgccgggcccgaggccgtcacccggctggtccaggagaccgaggccgacgtc
gtcctcaacgcgctggtgggggcgctgggcctgcggcccaccctggccgcgctggagtcg
ggcgcccggctggcgctggccaacaaggaatcgctgatcgccggcggtccgctggtgctc
aaggccgccaagcccggccagatcgtgccggtcgactccgaacattccgcgctggcccag
tgcctgcgcggcgggactcccgacgaagtcgccaagctggtgctgaccgcgtccggcggc
ccgttccgcggctggaccgccgcccagctcgaggacgtcacccccgagcaggccggcgcc
cacccgacgtggtcgatgggcccgatgaacacgctgaactcggcctcgctggtcaacaag
gggctcgagctcatcgagacccacctgctgttcggccttccctatgaccgcatcgaggtg
gtcgtgcacccccagtcgattgttcattcgatggtcaccttcgtcgacggctcgaccctc
gcccaggccagcccgccggacatgaggctgccgatcgcgctggccctgggctggccgcgc
cgggtgcccggcgcggccgcctcctgcgacttcagcacggcgtctagctgggaattcgag
cccctggacaacggcgtcttccccgccgtcgagttggcccggcacgccgggcagaccggc
ggctgcatgaccgcggtctacaacgccgccaacgaggaggcggcgcaggcgttcctggcg
ggccgcatcgggttcggtgccatcgtcaaaaccatcgccgacgtgctgcacgccgccgac
caatgggccgtctcacccgctaacgtggatgaggtactcgacgcgcagcgctgggcacgg
gagcgggcccagcgtgtcgtcgcacaggcgcagcccgccaacttatcggtcaaagcctcc
ggagcggtgtga

DBGET integrated database retrieval system