KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_05570Help
Entry
MIP_05570         CDS       T02325                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
Pathway
mid00010  Glycolysis / Gluconeogenesis
mid00030  Pentose phosphate pathway
mid00051  Fructose and mannose metabolism
mid00052  Galactose metabolism
mid00680  Methane metabolism
mid01100  Metabolic pathways
mid01110  Biosynthesis of secondary metabolites
mid01120  Microbial metabolism in diverse environments
mid01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MIP_05570
   00030 Pentose phosphate pathway
    MIP_05570
   00051 Fructose and mannose metabolism
    MIP_05570
   00052 Galactose metabolism
    MIP_05570
  Energy metabolism
   00680 Methane metabolism
    MIP_05570
Enzymes [BR:mid01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MIP_05570
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     MIP_05570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase AIRC
Motif
Other DBs
NCBI-ProteinID: AFS15744
UniProt: J9WEQ1
Position
complement(4066493..4067524)
Genome map
AA seq 343 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRTCDSRYGSSVVGFQDGWRGLLENRRVQLHNDDRNDR
LLAKGGTMLGTARVNPDKLRAGLNQVKQTLDDNGIDVLIPIGGEGTLTAAHWLSEENVPV
VGVPKTIDNDIDCTDVTFGHDTALTVATEAIDRLHSTAESHQRVMLVEVMGRHAGWIALN
AGLASGAHMTLIPEQPFDVEEVCRLVKRRFQRGDSHFICVVAEGAKPIPGSIALREGGID
EFGHEKFTGVAAQLGAEVEKRINKDVRVTVLGHVQRGGTPTAYDRVLATRFGVNAADAAH
AGEYGQMVSLRGQDIGRVPLADAVRQLKLVPDSRYDDAAAFFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcggagtgctcaccggaggcggcgactgccccgggctcaacgccgtcatccgg
gcggtggtgcgtacgtgcgactcccggtacggctcgtcggtggtcggatttcaggacgga
tggcgcgggttgctggagaaccggcgcgtccagctgcacaacgacgaccgcaacgaccgc
ctgctggccaagggcggaacgatgctggggaccgcgcgcgtgaatcccgacaaactgcgg
gccgggctgaaccaggtcaagcagaccctcgacgacaacgggatcgacgtcctcatcccg
atcgggggggaaggcacgctgacggccgcgcactggctctccgaggaaaacgttcccgtg
gtcggcgtgccgaagaccatcgacaacgacatcgattgcacggacgtgactttcggccac
gacaccgcgttgaccgtcgccaccgaggcgatcgaccggttgcacagcaccgccgagtcc
caccagcgcgtgatgctggtcgaggtgatgggccggcacgcgggttggattgcgctgaac
gcgggcctggcttccggcgcgcacatgacgctgatccccgagcagccattcgacgtcgaa
gaggtctgccggctcgtcaaacgtcgcttccagcgcggagattcgcacttcatctgcgtg
gtcgccgagggcgccaaacccatacccggctcgattgcgttgcgggaaggcgggattgac
gagttcggccacgagaaattcaccggtgtggccgcgcagctgggcgccgaggtggaaaag
cgcatcaacaaggacgtccgggtgaccgtcttgggtcacgtccagcgcggcggcaccccg
acggcatatgaccgggtgctggccacccggttcggcgtgaatgcggccgacgcggcgcat
gccggcgaatacggccagatggtgtcgctgcgcggccaggacatcggccgggtgccgctg
gccgatgccgtccgccagctcaagctggtgcccgacagccgctacgacgacgccgcggcc
ttcttcggctag

DBGET integrated database retrieval system