KEGG   Mycobacterium indicus pranii: MIP_05606Help
Entry
MIP_05606         CDS       T02325                                 

Definition
glycosyl transferase, group 1 family protein
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
mid  Mycobacterium indicus pranii
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MIP_05606
Enzymes [BR:mid01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     MIP_05606
Glycosyltransferases [BR:mid01003]
 Polysaccharide
  Storage polysaccharide
   MIP_05606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4090933..4092189
Genome map
AA seq 418 aa AA seqDB search
MDHEVKILMVSWEYPPVVVGGLGRHVHHLSTALAAAGHDVVVLSRRPTGTDPRSHPSSDQ
ISEGVRVIAAAQDPHEFTFGTDMMAWTLAMGHSMVRAGLSLKKPGSSHAWRPDVVHAHDW
LVAHPAIALAQFYDVPMVSTIHATEAGRHSGWVSGALSRQVHAVESWLVRESDSLITCSG
SMADEITELFGPGLAEITVICNGIETARWPFAARRPRTGPAELLYLGRLEYEKGVHDVIA
ALPRVRRTHPGTTLTIAGEGTQQGWLIEQARKHRVFKAIRFVGHLEHAELLAVLHRADAA
VLPSHYEPFGIVALEAAAAGTPLVTSNIGGLGEAVIDGRTGVSCPPRDVTRLAAAIRTVL
DDPRAAQQRARAARERLTSDFDWHTVADKTAQVYLSAKRGERQPQARLPIVEHALPDR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtggaccacgaagtgaagatcctgatggtgtcgtgggagtacccgccggtggtcgtcggc
gggctcggccggcacgtccaccacctgtccaccgcgctggcggccgcaggtcacgacgtc
gtggtgctgtcacgccgacccaccgggaccgatccccgcagccatccgtcgtccgaccag
atcagcgagggtgttcgggtgatcgcggccgcgcaggatccgcacgagttcaccttcggc
accgacatgatggcctggacgctcgcgatggggcattccatggtccgcgccgggctgagc
ctgaagaaacccggcagcagccacgcgtggcggcccgacgtcgtgcacgcccacgactgg
ctggtggcccatccggcgatcgcgctggcccaattctatgacgtgccaatggtttccacg
atccacgcgaccgaggccggtcggcattccggctgggtcagcggcgcgctcagccgtcag
gtgcacgcggtcgagtcctggctggtgcgcgaatccgattcgctgatcacctgttcgggg
tcgatggccgacgagatcaccgaactgttcggtccggggctggccgagatcaccgtgatc
tgcaacggcatcgagacggcgcggtggccgttcgcggcgcggcggccgcgcacggggccg
gccgaactgctttacctggggcggctggagtacgaaaagggggtgcacgacgtcatcgcc
gcgctcccgcgggtcaggcgcacccacccgggcaccacgctgaccatcgccggcgagggc
acccagcagggctggctcatcgagcaagcccgtaaacaccgggtgttcaaggcgattcgg
ttcgtcgggcacctcgagcacgcggagctgttggccgtactgcatcgcgccgacgccgcg
gtgttgcccagccactacgagccgttcggcatcgtggcgctcgaggcggccgcggccggc
actcccctggtgacgtcgaacatcggcgggctgggcgaggcggtgatcgacggtcggacc
ggcgtatcgtgcccgccccgggacgtgacccggctggccgcggcgattcgcaccgtcctc
gacgatccgcgcgccgcgcaacaacgcgcccgggccgcccgcgaacgcctcacgtccgac
ttcgattggcatacggtggccgacaagaccgcgcaggtctatctgtcggccaagcgcggc
gagcggcagccgcaggcgcggctccccatcgtcgaacacgccttgccggaccggtag

DBGET integrated database retrieval system