KEGG   Mycobacterium indicus pranii: MIP_05917Help
Entry
MIP_05917         CDS       T02325                                 

Definition
hypothetical protein
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mid  Mycobacterium indicus pranii
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:mid00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MIP_05917
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    MIP_05917
Enzymes [BR:mid01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     MIP_05917
Two-component system [BR:mid02022]
 CheA family
  CheA-CheYBV
   MIP_05917
Bacterial motility proteins [BR:mid02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    MIP_05917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4295652..4296437)
Genome map
AA seq 261 aa AA seqDB search
MATSRATSRASDRHLLVSDHHVLLSQGPTENGHRPAINALFRSVAVAFGPRAIGVLLSGV
LDDSVLGMGAIRARGGTAIGQSPEDALFPAMPVNAAEAGVVDRQADAADIGAVLKELSHR
EIEGFAMECDAAMELENRIAMRSRFATDFDTEKLGSPSGYTCPDCNGSLVSISEGNFRCQ
VGHAWTAEALLGARDNELEGALWIAVRSLREKARLARDMADRAGPGLLVRRYAAIAEETE
RALHVLSDRLSGAARQPGDAG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtggcgacctcgagggcgacctccagggcctccgatcgccacctgctcgtctccgaccat
cacgtcctgctgtcccaggggcccaccgagaacgggcatcggccggctatcaatgcgttg
ttccgatcggtcgccgtagcattcgggccccgcgcgatcggcgtgctgctgtccggcgtg
ctcgacgactccgtgctgggaatgggagccatccgtgcccgaggcggcaccgccatcggc
cagtcacccgaggacgcattgttccccgcgatgcccgtcaacgccgccgaggccggcgtg
gtggatcggcaggccgacgcggccgacatcggagccgtcctcaaagagctgtcgcaccga
gagatagagggttttgccatggagtgcgacgccgcgatggagctcgagaaccgcatcgcc
atgaggtcgcggttcgcgaccgacttcgacacggaaaaactggggtcgccgtccggctac
acctgccccgattgcaacggttcgctggtttccatcagtgagggcaacttccgctgccag
gtcggccacgcctggacggccgaagccttgctcggcgcgcgggacaacgagctcgagggg
gcgctgtggatcgcggtgcgcagcctgcgggaaaaggcccggctcgcaagggacatggcc
gacagggccgggccgggactgctcgtccgccgctacgcggcgatcgccgaggaaaccgaa
cgcgcgctgcacgtgctcagcgaccggctgtccggcgccgcccgacagccgggtgacgcc
ggatga

DBGET integrated database retrieval system